DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and MTG1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_612393.2 Gene:MTG1 / 92170 HGNCID:32159 Length:334 Species:Homo sapiens


Alignment Length:298 Identity:81/298 - (27%)
Similarity:129/298 - (43%) Gaps:53/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 KEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNNWIKYF 206
            |:.:..::..|.::||.|||.||..|....:..:    |.|..:|||||.||.........:::.
Human    40 KKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETL----GLKPHLLVLNKMDLADLTEQQKIMQHL 100

  Fly   207 RRSG-PVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMLGNYCRNKGIKTSIRV 270
            ...| ....|....:|:    ..:::..|.||             |:.....|.|.:.::..|. 
Human   101 EGEGLKNVIFTNCVKDE----NVKQIIPMVTE-------------LIGRSHRYHRKENLEYCIM- 147

  Fly   271 GVVGIPNVGKSSIINSLTR-----GRSCMVGSTPGVTKS-MQEVELDSK--IKLIDCPGIVFTSG 327
             |:|:|||||||:||||.|     |::..||..||:|:: |.::::..:  :.|:|.|| |....
Human   148 -VIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPG-VLAPR 210

  Fly   328 GENSHAVLKNAQRVGDVKDPF----TIAESVLKRASKEY---FCTMYDI-TNYDTFEEFFAKKAA 384
            .|:....||.| ..|.|.|..    |:|:.:|...:|..   :...|.: :..|..|......|.
Human   211 IESVETGLKLA-LCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAV 274

  Fly   385 RMGKFLKKGV-----------PDVVAAARSVLNDWNTG 411
            ::||..|..|           |:..||||..|..:..|
Human   275 KLGKTQKVKVLTGTGNVNIIQPNYPAAARDFLQTFRRG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 1/7 (14%)
RbgA 121..443 CDD:224083 81/298 (27%)
Nucleostemin_like 152..322 CDD:206753 52/178 (29%)
Ras_like_GTPase 271..>400 CDD:206648 46/155 (30%)
MTG1NP_612393.2 GTPase_YlqF 30..320 CDD:274669 81/298 (27%)
YlqF 30..207 CDD:206749 54/190 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.