DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and MTG1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_013815.1 Gene:MTG1 / 855122 SGDID:S000004703 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:72/269 - (26%)
Similarity:103/269 - (38%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KYKNAVT--KEQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVL 188
            ||...:|  |...:|. .|.|.|::...::::|:.|.|.||.||....:|..|......:|| |.
Yeast    26 KYSMPLTDFKGHQVKA-LKTFEKLLPQMNMIIELRDIRAPLSTRNVVFDRIARKEHDVMKLV-VY 88

  Fly   189 NKADLVPRE-----NLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKL--------REMKTEKAM 240
            .:.||:|..     .|.||.:....       |....|..|:...|.|        .|::|.   
Yeast    89 TRKDLMPGNKPYIGKLKNWHEELGE-------KFILLDCRNKTDVRNLLKILEWQNYELETN--- 143

  Fly   241 QGSVCIGAELLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSL--------TRGRS----C 293
                           |.|     :....|..:.|:||||||::||||        ..||.    .
Yeast   144 ---------------GGY-----LPMGYRALITGMPNVGKSTLINSLRTIFHNQVNMGRKFKKVA 188

  Fly   294 MVGSTPGVTKSMQEV--------ELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVK----D 346
            ..|:..|||::..||        |..::|.|||.||| ...|..:.|..:......|.||    |
Yeast   189 KTGAEAGVTRATSEVIRVTSRNTESRNEIYLIDTPGI-GVPGRVSDHNRMLGLALCGSVKNNLVD 252

  Fly   347 PFTIAESVL 355
            |...|:.:|
Yeast   253 PIFQADYLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 8/25 (32%)
RbgA 121..443 CDD:224083 72/269 (27%)
Nucleostemin_like 152..322 CDD:206753 53/202 (26%)
Ras_like_GTPase 271..>400 CDD:206648 36/109 (33%)
MTG1NP_013815.1 RbgA 18..367 CDD:224083 72/269 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.