DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and AtNug2

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_175706.1 Gene:AtNug2 / 841731 AraportID:AT1G52980 Length:576 Species:Arabidopsis thaliana


Alignment Length:660 Identity:168/660 - (25%)
Similarity:258/660 - (39%) Gaps:180/660 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKTKKSKRLTGRLKHKIEKKVRDHNKK--ERRAA---------KKNPKKG------SKKQKLIQI 53
            :|.:|...::|:.||.::....|..||  |.|:.         |..||:.      |.:.:..::
plant     2 VKKEKKANVSGKPKHSLDANRADGKKKTTETRSKSTVNRLKMYKTRPKRNAGGKILSNEYQSKEL 66

  Fly    54 PN--ICP------------------FKDD-----------ILKE------VEEAKQRQEAERLAR 81
            ||  |.|                  |:::           ||||      :....::|....|..
plant    67 PNSRIAPDRRWFGNTRVVNQKELEYFREELQTKMSSNYNVILKERKLPMSLLTDNKKQSRVHLLD 131

  Fly    82 REAF------KAEREQNKF--KTLESMVEDADMRSTVHGIMHENDAQDQDEKKYKNAV------- 131
            .|.|      |.:|::.|.  ...|::|:.|              |:.||..:.||..       
plant   132 MEPFQDAFGRKTKRKRPKLVASDYEALVKKA--------------AESQDAFEEKNGAGPSGEGG 182

  Fly   132 ---------------TKEQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGN 181
                           .|.|| |:.:.|..|||:::||:::|:|||||.||||:.:|:.::....:
plant   183 EEEDGFRDLVRHTMFEKGQS-KRIWGELYKVIDSSDVIVQVIDARDPQGTRCHHLEKTLKEHHKH 246

  Fly   182 KRLVLVLNKADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCI 246
            |.::|:|||.||||......|::...:..|..||.||....                       .
plant   247 KHMILLLNKCDLVPAWATKGWLRVLSKEYPTLAFHASVNKS-----------------------F 288

  Fly   247 GAELLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELD 311
            |...|:|:|..:.|.|..|.:|.||.||.|||||||:||:|.....|.|...||.||..|.:.|.
plant   289 GKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQYITLT 353

  Fly   312 SKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFE 376
            .:|.||||||:|:.|....:..|||...||.:::|.......||:|..||:....|.|.:::...
plant   354 KRIFLIDCPGVVYQSRDTETDIVLKGVVRVTNLEDASEHIGEVLRRVKKEHLQRAYKIKDWEDDH 418

  Fly   377 EFFAKKAARMGKFLKKGVPDVVAAARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEARE 441
            :|..:.....||.||.|.||::..|:.:|:||..|:|.:...||::....|.  |..||....:|
plant   419 DFLLQLCKSSGKLLKGGEPDLMTGAKMILHDWQRGRIPFFVPPPKLDNVASE--SEVIVPGIDKE 481

  Fly   442 FDVENFESMETEILEHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEKPAKGRK 506
            ...:|                                  .:|..|.|..|.::..:::|....::
plant   482 AIADN----------------------------------SQAAAALKAIAGIMSTQQQKDVPVQR 512

  Fly   507 RKLDEEKEKVDPSLLLEENQSLNKGIKQMQKLKKKQNVRNEKKISKITDVLDSFSLGPSSSKAEK 571
            ...||:..|.|                      ||.....|......||..:.............
plant   513 DFYDEKDLKDD----------------------KKAKESTETDAENGTDAEEDEDAVSEDGVESD 555

  Fly   572 YDFDEDYVIE 581
            .|.|||.|.|
plant   556 SDADEDAVSE 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863 25/130 (19%)
SurA_N_3 59..>150 CDD:304439 28/137 (20%)
RbgA 121..443 CDD:224083 113/343 (33%)
Nucleostemin_like 152..322 CDD:206753 64/169 (38%)
Ras_like_GTPase 271..>400 CDD:206648 51/128 (40%)
AtNug2NP_175706.1 NGP1NT 44..169 CDD:285379 26/138 (19%)
RbgA 199..484 CDD:224083 109/310 (35%)
NGP_1 208..364 CDD:206751 68/178 (38%)
HARE-HTH <533..573 CDD:294801 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.