DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and gnl1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001072441.1 Gene:gnl1 / 779895 XenbaseID:XB-GENE-481292 Length:612 Species:Xenopus tropicalis


Alignment Length:661 Identity:146/661 - (22%)
Similarity:249/661 - (37%) Gaps:185/661 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRLKTKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKK------------------ 47
            |..|:..:.|.|:     |...:|:.|.....|:..|:.|.:.||::                  
 Frog     1 MPRKKPFSNKQKK-----KQLQDKRERKRGPSEQGRAESNSRSGSRERWEENTDTSDSESLRPQL 60

  Fly    48 QKLIQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESMVE---DADMRST 109
            :::.|.|.|  ||..      |........||...:..|.|.||.|...||.::|   ::::...
 Frog    61 RRVNQQPQI--FKPG------ERNYDPNRYRLYFEKETKEEIEQRKKIALEKILEPVPESELEVH 117

  Fly   110 VHGI------------------MHENDAQDQDEKKYKNAVTK-------------EQSLKQYFKE 143
            :..|                  |.:...|.::||.:|..:.|             :.:|:.: ::
 Frog   118 IDQIYRPGSVLDFPKRPAWTYEMSKEAVQSREEKAFKEYLQKIYESHNPRELSYFDHNLETW-RQ 181

  Fly   144 FRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPG---------NKRLVLVLNKADLVPRENL 199
            ..:|:|.:|::|.:.|.|.|:          :..:|.         .:.|:|||||.||.|...:
 Frog   182 LWRVLEMSDIILLITDIRHPV----------LHFSPALYDYVTQELGRSLILVLNKTDLAPPSLV 236

  Fly   200 NNWIKYFRRSGP------VTAFKASTQDQAN-----RLGRRKLR----EMKTEKAMQGSVCIGAE 249
            ..|..||:...|      .|::....:::.:     :..|||.|    .:...:.::....|.||
 Frog   237 VAWKHYFQAKFPKVHVVCFTSYPRHPEEEQDPSAVFKKRRRKRRVWSSALGPSQLLRACEVITAE 301

  Fly   250 LL------------MSMLGNYCRNKGIKTS------------------------------IRVGV 272
            .:            .:.|.|....:|.:..                              :.:|.
 Frog   302 KVDLTSWREKIERDSAALCNPASEEGTQDEETDELNAVVSHQITDAELGAPSSELYKDGVLSIGC 366

  Fly   273 VGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKN 337
            ||.|||||||:||.|...:...|..|||.||..|...|...::|.||||::|.|..:....:|..
 Frog   367 VGFPNVGKSSLINGLVGKKIVSVSRTPGHTKYFQTYYLTPTVRLCDCPGLIFPSLIDRQQQILAG 431

  Fly   338 AQRVGDVKDPFTI---------AESVLK---RASKEYFCTMYDITNYDTFEEFFAKKAARMGKFL 390
            ...:..:::|:|.         ...:||   .:..|...|.:.|.      |.:|.|  |..|..
 Frog   432 IYPIAQIQEPYTSVGYLSCRIPVPQLLKLPQPSGVEGGWTAWSIC------EAWADK--RGYKTA 488

  Fly   391 KKGVPDVVAAARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEAREFDVENFESMETEIL 455
            |....|...||.|:|.....|::..|.:||    |.||...|...|.|.:|..|.: ::......
 Frog   489 KASRSDTYRAANSLLRLAVDGRLCLCMRPP----GYSVQKEAWQQHPETKEMAVHS-QAQGQANN 548

  Fly   456 EHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEKPA-----KGRKRKLDEEKEK 515
            :..:.:.::..||:|:|..|..|.|:..|..         ||:|.|.     :|.|.|:.:    
 Frog   549 DPSSGREEEEEEISSSGEEEEEQDRDADEEE---------DEEEDPTQSQHKRGNKNKVTD---- 600

  Fly   516 VDPSLLLEENQ 526
            ::|..||.|::
 Frog   601 INPFELLGEDE 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863 17/88 (19%)
SurA_N_3 59..>150 CDD:304439 22/124 (18%)
RbgA 121..443 CDD:224083 95/412 (23%)
Nucleostemin_like 152..322 CDD:206753 55/235 (23%)
Ras_like_GTPase 271..>400 CDD:206648 43/140 (31%)
gnl1NP_001072441.1 RbgA 174..513 CDD:224083 81/357 (23%)
HSR1_MMR1 178..419 CDD:206750 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.