DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and Ns4

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster


Alignment Length:588 Identity:130/588 - (22%)
Similarity:218/588 - (37%) Gaps:170/588 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTKKSKRLTGRLKHKIEKKVR---------DHNKKERRAAKKNPKKGSKKQKLIQIPNICPFKDD 62
            |.||.:.|..|......|.:|         |..:..|:..::...:|..:.|.:...|: .|..:
  Fly    13 KKKKDQMLQKRNTKGPPKYLRSTQESYEDSDVPETTRKLMEQPFARGGNRNKNVNRYNL-QFYQE 76

  Fly    63 ILKEVEEAKQRQEAERLARREAFK-------AERE-QNKF-----------KTLESMVEDADMRS 108
            ..||:|:.||          |.||       |:|| .:::           .||....|:.|...
  Fly    77 GKKELEQMKQ----------EGFKPFEKLSPAQREVDDRYFAGCDFPVRPPWTLTESKEELDRTE 131

  Fly   109 TVHGIMHENDAQDQDEKKYKNAVTKEQSL----KQYFKEFRKVIENADVVLEVVDARDPLGTRCN 169
            .    .:..:..|:.:||.:...:||.||    .:.:::..:|:|.:|::|.:||.|        
  Fly   132 N----RYFKEYVDELQKKQRAGDSKELSLFELNLETWRQLWRVLEFSDILLIIVDVR-------- 184

  Fly   170 EVERAVRGAPG---------NKRLVLVLNKADLVPRENLNNWIKYFR---RSGPVTAF------- 215
              ...:...|.         .|..::|.||.|||....:..|.:|||   ...||..|       
  Fly   185 --YATLMFPPSLYDYIINTLKKHAIVVFNKVDLVEPHAVVAWRQYFRDRYPQLPVVLFASFLPRS 247

  Fly   216 -KASTQ-DQANRLG------------------------RRKLRE-MKTEK---------AMQGSV 244
             |.|.: .||:|..                        .:|:|| |::::         |::|.:
  Fly   248 RKGSQRGPQAHRRSMEGVYNIYKECQRYVQGEVDLTTWEQKIREDMRSDQLDILDEISTAVEGEL 312

  Fly   245 CIGAELLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVE 309
            .|.:.:..:...:...:.|:.|   :|.:|.|||||||:||:|...:...|..|||.||..|.:.
  Fly   313 KISSSIDTTPHEHVKYHSGVLT---IGCIGFPNVGKSSLINALKGRKVVSVSRTPGHTKHFQTIF 374

  Fly   310 LDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDT 374
            |...::|.||||:||.|....|..||..:..:..:..|:...:.:.:..:......::...:||.
  Fly   375 LTPLVRLCDCPGLVFPSSTPKSLQVLLGSFPISQLAVPYRSLKFLGEHLNLPQLLRLHLPEDYDE 439

  Fly   375 FEE------------FFAKKAARMGKFLKKGVPDVVAAARSVL---------------------- 405
            :..            |...||||         ||...||..:|                      
  Fly   440 WSAVAISDAWAYKRGFLTAKAAR---------PDRYRAANHILRMCLAGQQMLVLQFYPPGFEER 495

  Fly   406 -NDW----NTGKIKYCTQ-----PPEVQEGQSVHISASIVHSEAREFDVENFESMETEILEHCAV 460
             ..|    :.|::|...|     |.....|.:..:.:....||..:.|..|.|:...|  |.|.:
  Fly   496 REHWLQHPDVGEVKKYQQVELDEPESETNGDTSSVCSDTADSEDEDEDSSNDETNADE--EECGI 558

  Fly   461 KTD 463
            :.|
  Fly   559 RED 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863 17/86 (20%)
SurA_N_3 59..>150 CDD:304439 24/113 (21%)
RbgA 121..443 CDD:224083 95/424 (22%)
Nucleostemin_like 152..322 CDD:206753 58/224 (26%)
Ras_like_GTPase 271..>400 CDD:206648 41/140 (29%)
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 62/239 (26%)
GTPase_YlqF 165..474 CDD:274669 79/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435331
Domainoid 1 1.000 42 1.000 Domainoid score I753
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.