DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and GTPBP8

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_054889.2 Gene:GTPBP8 / 29083 HGNCID:25007 Length:284 Species:Homo sapiens


Alignment Length:86 Identity:25/86 - (29%)
Similarity:39/86 - (45%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 VGIPNVGKSSIIN---SLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAV 334
            :|..||||||:|.   ||.......|...||.||.|...::.....::|.||..|.:..:....|
Human   116 IGRSNVGKSSLIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMV 180

  Fly   335 LKNAQRVGDVKDPFTIAESVL 355
            ....:...::|..|.:.:||:
Human   181 ETYLKERRNLKRTFLLVDSVV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439
RbgA 121..443 CDD:224083 25/86 (29%)
Nucleostemin_like 152..322 CDD:206753 18/51 (35%)
Ras_like_GTPase 271..>400 CDD:206648 25/86 (29%)
GTPBP8NP_054889.2 YihA_EngB 112..280 CDD:206665 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.