DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and Mtg1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_955005.2 Gene:Mtg1 / 212508 MGIID:2685015 Length:326 Species:Mus musculus


Alignment Length:314 Identity:78/314 - (24%)
Similarity:127/314 - (40%) Gaps:85/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 KEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNNWIKYF 206
            |:.:..:::.|.|:||.|||.|...| |.:.:.:.|.   |..:|||||.||             
Mouse    39 KKMQSSLKSVDCVIEVHDARIPFSGR-NPLFQELLGL---KPHLLVLNKMDL------------- 86

  Fly   207 RRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSV---CIGAELLMSMLG--------NYCR 260
                            |:...::|:.:...||.:...:   |:..|.:..::.        :|..
Mouse    87 ----------------ADLTEQQKIVQRLEEKGLSNVLFTNCVKDENIKQIVPKVMELIRCSYRY 135

  Fly   261 NKGIKTSIRVGVVGIPNVGKSSIINSLTR-----GRSCMVGSTPGVTKSM-QEVELDSK--IKLI 317
            ::.......:.|||:|||||||:||||.|     |::..||..||:|::: ..:::..:  :.|:
Mouse   136 HRAETPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQVCERPLVFLL 200

  Fly   318 DCPGIVFTSGGENSHAVLKNAQRVGDVKDPF----TIAESVLKRASKEYFCTMYDITNY------ 372
            |.|| |.....|:....||.| ..|.|.|..    |:|:.:|      |....:.:..|      
Mouse   201 DTPG-VLAPRIESVETGLKLA-LCGTVLDHLVGEETMADYLL------YTLNRHGLFGYVQHYAL 257

  Fly   373 ----DTFEEFFAKKAARMGKFLKKGV-----------PDVVAAARSVLNDWNTG 411
                |..|......|.::.|..|..|           ||...|||..|..:.:|
Mouse   258 ASACDQIEWVLKNVAIKLRKTRKVKVLTGTGNVNVIQPDYAMAARDFLRTFRSG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 1/7 (14%)
RbgA 121..443 CDD:224083 78/314 (25%)
Nucleostemin_like 152..322 CDD:206753 50/188 (27%)
Ras_like_GTPase 271..>400 CDD:206648 46/161 (29%)
Mtg1NP_955005.2 GTPase_YlqF 29..319 CDD:274669 78/314 (25%)
YlqF 29..206 CDD:206749 52/200 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.