DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and mtg1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_021336162.1 Gene:mtg1 / 100150980 ZFINID:ZDB-GENE-031110-2 Length:319 Species:Danio rerio


Alignment Length:322 Identity:80/322 - (24%)
Similarity:131/322 - (40%) Gaps:71/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EQSLKQYF--------KEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNK 190
            |:.:..:|        |:.|..:.|.|.::|:.|||.|...|.:..:.::...|.    :|||||
Zfish    21 ERDVTHWFPRHMAKGLKQMRANLRNVDCIIEIHDARIPFSGRNSSFQESLDVRPH----LLVLNK 81

  Fly   191 ADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRR------KLREMKTEKAMQGSVCIGAE 249
            .|:.......:.:|.|.|.|...........|.:...::      ||.|..:....:...|    
Zfish    82 MDVADISKKQSILKQFEREGVKNVLFTDCLRQHDENVKKIVPLVSKLIESTSRFHREEERC---- 142

  Fly   250 LLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTR-----GRSCMVGSTPGVTKS-MQEV 308
                    ||          :.|:|:|||||||:||:|.|     |::..||:.||:||: :.::
Zfish   143 --------YC----------LMVIGVPNVGKSSLINALRRTYLKKGKASKVGAEPGITKAVLTKI 189

  Fly   309 ELDSK--IKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESV--------LKRASKEYF 363
            ::..:  |.|:|.|| |.....||....:|.| ..|.|.| ..:.|.|        |.|..:..:
Zfish   190 QVCERPIIHLLDTPG-VLPPRIENIETGMKLA-LCGTVLD-HLVGEDVIADFLLFSLNRLERFSY 251

  Fly   364 CTMYDITN-YDTFEEFFAKKAARMGKFLK----KGV-------PDVVAAARSVLNDWNTGKI 413
            ...|.:.. .|..:......|.::||..:    .||       ||..|||...:..:..|::
Zfish   252 VEKYSLEEPCDDIQHVLKCIAVKLGKTRRVKAITGVGNITVQLPDYSAAAYDFIRAFRKGEL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 4/23 (17%)
RbgA 121..443 CDD:224083 80/322 (25%)
Nucleostemin_like 152..322 CDD:206753 49/183 (27%)
Ras_like_GTPase 271..>400 CDD:206648 46/156 (29%)
mtg1XP_021336162.1 RbgA 26..319 CDD:331156 79/317 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.