Sequence 1: | NP_732199.2 | Gene: | Ns1 / 42060 | FlyBaseID: | FBgn0038473 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106634.1 | Gene: | mtg1 / 100127874 | XenbaseID: | XB-GENE-957647 | Length: | 311 | Species: | Xenopus tropicalis |
Alignment Length: | 206 | Identity: | 56/206 - (27%) |
---|---|---|---|
Similarity: | 98/206 - (47%) | Gaps: | 38/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 EQSLKQYF--------KEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNK 190
Fly 191 ADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSML 255
Fly 256 GNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTR-----GRSCMVGSTPGVTKSMQ---EVELDS 312
Fly 313 KIKLIDCPGIV 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ns1 | NP_732199.2 | GN3L_Grn1 | 17..88 | CDD:285863 | |
SurA_N_3 | 59..>150 | CDD:304439 | 3/23 (13%) | ||
RbgA | 121..443 | CDD:224083 | 56/206 (27%) | ||
Nucleostemin_like | 152..322 | CDD:206753 | 51/177 (29%) | ||
Ras_like_GTPase | 271..>400 | CDD:206648 | 26/61 (43%) | ||
mtg1 | NP_001106634.1 | GTPase_YlqF | 20..311 | CDD:274669 | 55/201 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |