DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and mtg1

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001106634.1 Gene:mtg1 / 100127874 XenbaseID:XB-GENE-957647 Length:311 Species:Xenopus tropicalis


Alignment Length:206 Identity:56/206 - (27%)
Similarity:98/206 - (47%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EQSLKQYF--------KEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNK 190
            |:.:..:|        |:.:..::|.|.::||.|||.||..| |.:   .:.:.|.|..:|:|||
 Frog    15 EREVAHWFPGHMAKGLKQMKTKLKNLDCIVEVHDARIPLSGR-NPI---FQDSLGMKPHLLILNK 75

  Fly   191 ADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSML 255
            .||.........:...::.|               :|.....:...::.::..|.:.:| |:...
 Frog    76 MDLADLTQKKRILAQLKQQG---------------VGNVIFTDCVKDQNIKHVVPVISE-LVGCS 124

  Fly   256 GNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTR-----GRSCMVGSTPGVTKSMQ---EVELDS 312
            ..:.|.:..:|.|.  |:|:|||||||:||:|.|     |::..||:.||:|:|:.   :|....
 Frog   125 QRFHREENTETCIM--VIGVPNVGKSSLINALRRMHLRKGKASRVGAEPGITRSVLTKIQVSESP 187

  Fly   313 KIKLIDCPGIV 323
            .|.|.|.||::
 Frog   188 LIFLFDTPGVL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 3/23 (13%)
RbgA 121..443 CDD:224083 56/206 (27%)
Nucleostemin_like 152..322 CDD:206753 51/177 (29%)
Ras_like_GTPase 271..>400 CDD:206648 26/61 (43%)
mtg1NP_001106634.1 GTPase_YlqF 20..311 CDD:274669 55/201 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.