DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad and SMAD7

DIOPT Version :9

Sequence 1:NP_001369021.1 Gene:Dad / 42059 FlyBaseID:FBgn0020493 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_005895.1 Gene:SMAD7 / 4092 HGNCID:6773 Length:426 Species:Homo sapiens


Alignment Length:422 Identity:131/422 - (31%)
Similarity:184/422 - (43%) Gaps:94/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CCGGATESTSGSTLTIPVSTSRATAHPPQTQAQNGKRFREDFEAL----MKQLKRKQRNELLLAV 240
            |.|.|.....|          ....|||...|........|.:||    :|:||.:|...||.||
Human    61 CLGKAVRGAKG----------HHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAV 115

  Fly   241 KSRLDPPTKTQRDVVEPTTTTAPTYLQCILIPCKTQTVWEPHVTAS-----------------RL 288
            :||             ..|.||     |:|:|.:......|...|.                 ::
Human   116 ESR-------------GGTRTA-----CLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKV 162

  Fly   289 FFWRELWNAKELKRLPTCPAARDCIY-------MCCNPLHWFRILHQPETESPTPPYQRSKMLRL 346
            |.|.:|.::.|:|||..|.:     |       :||||.|..|:.   |.|||.|||.|..|   
Human   163 FRWPDLRHSSEVKRLCCCES-----YGKINPELVCCNPHHLSRLC---ELESPPPPYSRYPM--- 216

  Fly   347 KDADFEEDSQNDAKSAALSTWSAESTSISNIYKPALYES---VTTDGKDHNINSQVWCQIAYWEM 408
               ||.:.:. |...|..|  |||:...:.:....|.:|   :....:.|      ||.:||||.
Human   217 ---DFLKPTA-DCPDAVPS--SAETGGTNYLAPGGLSDSQLLLEPGDRSH------WCVVAYWEE 269

  Fly   409 AHRVGEFFHAKTNAVNIYTDGIVASEVDSMCLRDLTPAGNQIHSVVPKARHTVGLGVTLSLENGD 473
            ..|||..:..:..:::|:.|   ..:.:..||..|.  .:....:|.|.|..:|.|:.|:.|...
Human   270 KTRVGRLYCVQEPSLDIFYD---LPQGNGFCLGQLN--SDNKSQLVQKVRSKIGCGIQLTREVDG 329

  Fly   474 VWIYNRGNTTIFVDSPTLSENLDR----VCKVMPGYCLKAFETNRAELLSMRDHGHHPM-GPVDY 533
            ||:|||.:..||:.|.|| :|.|.    |.||.||:.:|||:..:|..| .|.:.|..| .|...
Human   330 VWVYNRSSYPIFIKSATL-DNPDSRTLLVHKVFPGFSIKAFDYEKAYSL-QRPNDHEFMQQPWTG 392

  Fly   534 FSIKISFGKGWGRDYKRQDIMGCPCWLEVHFS 565
            |:::|||.||||:.|.||.|..|||||||.|:
Human   393 FTVQISFVKGWGQCYTRQFISSCPCWLEVIFN 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DadNP_001369021.1 MH1_SMAD_6_7 197..329 CDD:199813 40/159 (25%)
MH2_I-SMAD 400..565 CDD:199821 66/169 (39%)
SMAD7NP_005895.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..55
MH1_SMAD_7 60..205 CDD:199818 45/179 (25%)
Important for interaction with SMURF2 208..217 5/14 (36%)
PY-motif 208..211 1/2 (50%)
MH2_SMAD_7 254..424 CDD:199825 67/182 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143879
Domainoid 1 1.000 118 1.000 Domainoid score I5859
eggNOG 1 0.900 - - E1_KOG3701
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6357
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D193735at33208
OrthoFinder 1 1.000 - - FOG0003707
OrthoInspector 1 1.000 - - otm40486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13703
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5077
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.