DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad and daf-14

DIOPT Version :9

Sequence 1:NP_001369021.1 Gene:Dad / 42059 FlyBaseID:FBgn0020493 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001255475.1 Gene:daf-14 / 177908 WormBaseID:WBGene00000910 Length:331 Species:Caenorhabditis elegans


Alignment Length:256 Identity:63/256 - (24%)
Similarity:109/256 - (42%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LKDADFEE---------DSQND-------AKSAALSTWSAESTSISNIYKPALYESVTTDGKDHN 394
            |:||...:         |..||       :..::|...:.|...:.  .:|...|.:..:.| :.
 Worm    67 LEDAPMPDCYNVPSTSTDENNDPFPFSNISSQSSLKPKTPEKAVVE--VRPTGNEMLDPEPK-YP 128

  Fly   395 INSQVWCQIAYWEMAHRVGEFFHAKTNAVNIYTDGIVASEVDSMCLRDLTPAGNQIHSVVPKARH 459
            ...:.||.|.|:|:..|:|:.|.||...:.|  ||  |:.....|...||...:..:|...:.|:
 Worm   129 KEEKPWCTIFYYELTVRLGKAFEAKVPTITI--DG--ATGASDECRMSLTSQPSSRNSKSSQIRN 189

  Fly   460 TVGLGVTLSLENGDVWIYNRGNTTIFVDSPTLSENLDRVCKV------------MPGYCLKAFET 512
            |||.|:.|:.|||::|:....:..:||..|.|::.|::..|.            |..:..:.||.
 Worm   190 TVGAGIQLAYENGELWLTVLTDQIVFVQCPFLNQTLNKPLKYVFRLQNKGDQKRMKIFDKEQFEQ 254

  Fly   513 NRAELLSMRDHGHHPMGPVD-----------YFSIKISFGKGWGRDYKRQDIMGCPCWLEV 562
            .:...|          ||:.           :.:|::||.||:|..|.|..::..|||:|:
 Worm   255 EKTLAL----------GPLTEKEVADERMRIFSNIRVSFCKGFGETYSRLKVVNLPCWIEI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DadNP_001369021.1 MH1_SMAD_6_7 197..329 CDD:199813
MH2_I-SMAD 400..565 CDD:199821 52/186 (28%)
daf-14NP_001255475.1 DWB 133..308 CDD:197770 52/187 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6357
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.