DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and MRM2

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_011379.1 Gene:MRM2 / 852741 SGDID:S000003104 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:62/280 - (22%)
Similarity:102/280 - (36%) Gaps:90/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILN---GVQRAVDLCAAPGSWSQVLSRKLYDT 66
            ::..:|.|.::||.:..|:|:||||:.:|:.|.:.:   ..||.:||..|||:||||..::    
Yeast    33 NRQLKDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQR---- 93

  Fly    67 CETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAI-------------------IGHF 112
                 ......|:.||:....|..|:..:|.:|..:.|.:.|                   .|:|
Yeast    94 -----SSPNSMILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFFSKHFQLNRHDDLHKDHGYF 153

  Fly   113 GG----------------------------NEKAQLVVCDGAP---------------------- 127
            ..                            |..:.|:..:..|                      
Yeast   154 QNMLEEELTHVKDTELYREIFTSDDIYETPNTNSTLIEREKFPVDVIISDMYEPWPQTTGFWNNI 218

  Fly   128 ---------DVTGVHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFK 183
                     :.:||...|.|....|..|||..|..:|...|:||.|::.|...:|...:||..|.
Yeast   219 TNQAYFRMANTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFT 283

  Fly   184 KFDIYKPPSSRPSSIEAFVV 203
            ....:||.:||..|.|.:.:
Yeast   284 NVHKFKPDASRDESKETYYI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 62/280 (22%)
MRM2NP_011379.1 RlmE 25..310 CDD:223370 62/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.