DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and AT4G25730

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_194303.2 Gene:AT4G25730 / 828678 AraportID:AT4G25730 Length:821 Species:Arabidopsis thaliana


Alignment Length:343 Identity:94/343 - (27%)
Similarity:153/343 - (44%) Gaps:78/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKT-SKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLY 64
            |||. .|.:.|.|||.||:.|:|:|:::|||.:|..|.:|:.....:|||||||.|.||...|: 
plant     1 MGKVKGKHRLDKYYRLAKERGFRSRASYKLLQLDAKYSLLHSAHAVLDLCAAPGGWMQVAVEKV- 64

  Fly    65 DTCETDDEKSAVKIIAVDLQAMAPIRGILQLQGDIT----KQSTAEAIIGHFGGNEKAQLVVCDG 125
                    .....::.:||..:.|:||.:.:..|||    |....:.:..|  |.....||:.||
plant    65 --------PVGSLVLGIDLVPILPVRGCVTMTQDITRTECKSKIKQVMEQH--GVSAFNLVLHDG 119

  Fly   126 APDVTGVHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKP 190
            :|:|.|....:...|:.|::.::.:||..|...|..|.|:|:....:.:...:...|:|.:::||
plant   120 SPNVGGAWAQEAMSQNALVIDSVRLATEFLARNGNLVTKVFRSRDYNSVLYCLGRLFEKVEVFKP 184

  Fly   191 PSSRPSSIEAFVVCSDFCLPEGYIPQVINPARDDIRLLAQ----KTGSEVNRRLVPFIACGDLNG 251
            |:||.:|.|.::|...:          :.||:.|.|||..    |..:|..|::|      |:.|
plant   185 PASRSASAETYLVGLKY----------LAPAKIDPRLLDYRHLFKESAEPTRKVV------DVLG 233

  Fly   252 LSDPEEGKTSSSD-ES-----KSNLEYVYD-------------AVMDDASYPL------------ 285
            .|..:..:....| ||     .|..::::.             :..|.||.||            
plant   234 GSKQKRNRDGYEDGESILRRVASAADFIWSENPLDVLGTTTSISFDDQASLPLKEHDLTTEEIKI 298

  Fly   286 -----------EFKEILK 292
                       :||.|||
plant   299 LCDDLPVLGKNDFKHILK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 65/212 (31%)
AT4G25730NP_194303.2 RlmE 6..204 CDD:223370 64/218 (29%)
DUF3381 236..382 CDD:288694 14/81 (17%)
Spb1_C 599..788 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.