DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and CG11447

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster


Alignment Length:205 Identity:60/205 - (29%)
Similarity:93/205 - (45%) Gaps:15/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYDTCETDDEKS 74
            |.|..:|:...:|.|||||||.:|:.||||......::..||||||:||...:   |.....::.
  Fly    48 DPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVER---TNANGKQER 109

  Fly    75 AVK--IIAVDLQAM-----APIRGILQLQGDITKQSTAEAIIGHFGGNEKAQLVVCDGAPDVTGV 132
            |.:  :.::||...     |.|.|.:.....:.::...||:     .:.|...|:.|.||:.|||
  Fly   110 APQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREAL-----QDRKVNCVLSDMAPNATGV 169

  Fly   133 HEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPSS 197
            ..:|:.....|....|..|..:.......|.|::.......|...|..|::|....||.:||..|
  Fly   170 RMLDQESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDS 234

  Fly   198 IEAFVVCSDF 207
            .|.|:|..:|
  Fly   235 AEHFLVARNF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 60/205 (29%)
CG11447NP_650835.1 RlmE 35..246 CDD:223370 60/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.