DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and Mrm2

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001100595.1 Gene:Mrm2 / 304323 RGDID:1305944 Length:246 Species:Rattus norvegicus


Alignment Length:200 Identity:62/200 - (31%)
Similarity:105/200 - (52%) Gaps:3/200 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYDTCETDDEK 73
            :|.:.:.||.|.:|.|||||||.::|.:.||....|.:|..||||:||||..:.:..| ..|...
  Rat    40 KDPFVKAAKAESYRCRSAFKLLEMNEKHHILRPGLRVLDCGAAPGAWSQVAVQSVNAT-GADSSS 103

  Fly    74 SAVKIIAVDLQAMAPIRGILQL-QGDITKQSTAEAIIGHFGGNEKAQLVVCDGAPDVTGVHEMDE 137
            ....::.|||..|.|:.|...| ..|:|...|.:.|: ......:|.:::.|.||:.||:.::|.
  Rat   104 PMGFVLGVDLLHMFPLAGATFLCPADVTDPRTFQRIL-ELLPRRRADVILSDMAPNATGIRDLDH 167

  Fly   138 YMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPSSIEAFV 202
            .....|.:..:.:|..:|..|||.:.|.:.|:.:.||..::...|:...:.||.:||..|.|.::
  Rat   168 DRLISLCLTLVDMAVDILHPGGTLLCKTWAGSKSHLLQKRLAQEFRSTRVVKPEASRKESAEVYL 232

  Fly   203 VCSDF 207
            :.:.:
  Rat   233 LATQY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 62/199 (31%)
Mrm2NP_001100595.1 RlmE 33..241 CDD:223370 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.