DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and F45G2.9

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_499776.1 Gene:F45G2.9 / 185813 WormBaseID:WBGene00009735 Length:214 Species:Caenorhabditis elegans


Alignment Length:227 Identity:65/227 - (28%)
Similarity:103/227 - (45%) Gaps:35/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKTSKDKRDIY---YRQAKDE--------GWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGS 54
            |..|.|.:.:::   .||:.||        .:||||||||:.::|.:..|......:|:..||||
 Worm     1 MFSTKKSQGNLHKYIQRQSTDEFAVKAREHNYRARSAFKLIEINEKFKFLKPESTVIDIGCAPGS 65

  Fly    55 WSQVLSRKLYDTCETDDEKSAVKIIAVDLQAMAPIRG--ILQLQGDITKQSTAEAI---IGHFGG 114
            |.||:.:|    |......      .||||.:.||||  ||.| .|||..:....|   :.|   
 Worm    66 WLQVVVQK----CPNGYAS------GVDLQNVLPIRGADILSL-SDITDPAVKLKIREKLAH--- 116

  Fly   115 NEKAQLVVCDGAPDVTGVHEMDEYMQHQLLVAALSIAT----CVLETGGTFVAKIFKGNATSLLS 175
             .:..:|:.|.||:.||.:..|.....:|..:...:.:    ..|...|.::.||:.|:|.:...
 Worm   117 -RQVDVVLSDMAPNPTGDNATDHLRLIELCRSVFRLFSVENEIELVKNGVYLCKIWDGSARAEFV 180

  Fly   176 SQMQIFFKKFDIYKPPSSRPSSIEAFVVCSDF 207
            .::...|......||.:.|.:|.|.::.|.:|
 Worm   181 RELSDRFSTVKTVKPTACRDNSAELYLFCRNF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 64/225 (28%)
F45G2.9NP_499776.1 RlmE 4..214 CDD:223370 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.