DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and H06I04.3

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_497655.1 Gene:H06I04.3 / 175414 WormBaseID:WBGene00019168 Length:833 Species:Caenorhabditis elegans


Alignment Length:241 Identity:89/241 - (36%)
Similarity:131/241 - (54%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYDTC 67
            |..|.:||.||:.||:.|:|:|:||||:.:::.:..|...:..||||||||.|.||.|:.:    
 Worm     6 KIGKQRRDKYYKLAKEAGYRSRAAFKLVQLNKRFEFLEKSRATVDLCAAPGGWMQVASQFM---- 66

  Fly    68 ETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAIIGHFGGNEK------AQLVVCDGA 126
                 ..:..|:.|||..:.||:..:.||||||...|..||       :|      |..|:.|||
 Worm    67 -----PVSSLIVGVDLAPIKPIKNCIALQGDITTNETRAAI-------KKELKTWSADCVLHDGA 119

  Fly   127 PDV--TGVHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYK 189
            |:|  ..||  |.:.|:.|.::||.:||.:|..|||||.|:|:.|..|.|....:..||:..::|
 Worm   120 PNVGLNWVH--DAFQQNCLTLSALKLATQILRKGGTFVTKVFRSNDYSCLIRVFEKLFKRVHVWK 182

  Fly   190 PPSSRPSSIEAFVVCSDFCLPEGYIPQVINPARDDIRLLAQKTGSE 235
            |.:||..|.|.||||..:..|:....:.::|.    ::.|...|||
 Worm   183 PAASRLESAEIFVVCEVYQKPDKVGAEYLDPK----KVFANPDGSE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 83/215 (39%)
H06I04.3NP_497655.1 RlmE 8..197 CDD:223370 80/206 (39%)
DUF3381 237..368 CDD:288694
Spb1_C 618..800 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.