DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and FTSJ3

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_060117.3 Gene:FTSJ3 / 117246 HGNCID:17136 Length:847 Species:Homo sapiens


Alignment Length:302 Identity:93/302 - (30%)
Similarity:150/302 - (49%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYDT 66
            ||..|.:||.:|..||:.|:|:||||||:.::..:..|...:..:|||||||.|.||.::.:   
Human     5 GKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKFM--- 66

  Fly    67 CETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAIIGHFGGNEKAQLVVCDGAPDVTG 131
                  ..:..|:.|||..:.|:..::.||.|||.:...:|:.... ...|..:|:.||||:|..
Human    67 ------PVSSLIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKEL-KTWKVDVVLNDGAPNVGA 124

  Fly   132 VHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPS 196
            ....|.|.|..|.:.||.:|...|..||:|:.|:|:......|....|..|::....||.:||..
Human   125 SWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWIFQQLFRRVQATKPQASRHE 189

  Fly   197 SIEAFVVCSDFCLPEGYIPQVINP--ARDDIRLLAQKTGSEVNRRLVP---FIACGDLNGLSDPE 256
            |.|.||||..|..|:....:..:|  |..::.:.| ||.:|:..:..|   ..|.|||....   
Human   190 SAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQA-KTVTELVTKKKPKAEGYAEGDLTLYH--- 250

  Fly   257 EGKTSSSD--ESKSNLEYVYDA---VMDD---ASYPLEFKEI 290
              :||.:|  .:.:.::::..|   ::||   |.:|...::|
Human   251 --RTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 71/207 (34%)
FTSJ3NP_060117.3 RlmE 8..203 CDD:223370 70/204 (34%)
DUF3381 232..400 CDD:288694 14/64 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 558..653
Spb1_C 644..834 CDD:285075
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 811..847
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.