DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5220 and ftsj3

DIOPT Version :9

Sequence 1:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_012822455.1 Gene:ftsj3 / 100145257 XenbaseID:XB-GENE-5797493 Length:850 Species:Xenopus tropicalis


Alignment Length:304 Identity:96/304 - (31%)
Similarity:144/304 - (47%) Gaps:52/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYDTC 67
            |..|.::|.:|..||:.|:|:||||||:.::..:..|...:..||||||||.|.||.::.:    
 Frog     6 KVGKSRKDKFYHLAKETGYRSRSAFKLIQLNRKFQFLPKARALVDLCAAPGGWLQVAAKFM---- 66

  Fly    68 ETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAIIGHFGGNEKAQLVVCDGAPDVTGV 132
                 ..:..||.|||..:.||..:|.||.|||.::..:.:..|. ...||.:|:.||||:|...
 Frog    67 -----PISSLIIGVDLVPIKPIPKVLTLQEDITTEACRQTVRKHL-QTWKADVVLNDGAPNVGAN 125

  Fly   133 HEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPSS 197
            ...|.:.|..|.:.||.:|...|..||.|:.|||:.:....|...:|.||||.:..||.:||..|
 Frog   126 WTHDAFSQVHLSLMALRLACDCLSRGGWFITKIFRSSDYQSLLWILQQFFKKVNSTKPQASRSES 190

  Fly   198 IEAFVVCSDFCLPEGYIPQVINP--ARDDI--------RLLAQK---------TGSEVNRR--LV 241
            .|.||||..|..|:....:..:|  |..|:        :||:.|         |...:..|  ||
 Frog   191 AEIFVVCQGFLAPDKIDTRFFDPKFAFKDVDGPVQTVSQLLSHKKPKAEGYAATSLSLYHRASLV 255

  Fly   242 PFIACGDLNGLSDPEE--GKTSSSDESKSNLEYVYDAVMDDASY 283
            .|:.      :.:|.:  .|||             :.::||..:
 Frog   256 DFLT------VENPVDFLSKTS-------------EIILDDTEF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5220NP_650590.1 RlmE 3..211 CDD:223370 78/207 (38%)
ftsj3XP_012822455.1 RlmE 4..203 CDD:223370 78/206 (38%)
DUF3381 234..373 CDD:371767 12/66 (18%)
Spb1_C 647..850 CDD:369515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.