DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and AT5G60010

DIOPT Version :10

Sequence 1:NP_650588.2 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_200809.4 Gene:AT5G60010 / 836123 AraportID:AT5G60010 Length:886 Species:Arabidopsis thaliana


Alignment Length:227 Identity:45/227 - (19%)
Similarity:90/227 - (39%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DIRNRFSPTIALLQTLLVREHN---RLAENLALINPDHSDE------RIFQEARKINIAQ-FQKI 347
            ::|:||:.|....|.....:.|   |:....|.:|| |.:|      :||.:......|| :||.
plant   627 ELRSRFAKTCEPTQAAAKPKPNSLMRMETRAAGVNP-HIEESQVLFPKIFIKGPYGAPAQNYQKF 690

  Fly   348 TYYDWLPLFVGRT--YTYLNGLIYPVEP------TEYVNDY------DETVNPAAYAEFSAAAFR 398
            .....:.|.:|.|  .:.|..::..::|      .:|....      .::|:.....:|...|:.
plant   691 DILLLVGLGIGATPFISILKDMLNHLKPGIPRSGQKYEGSVGGESIGGDSVSGGGGKKFPQRAYF 755

  Fly   399 YAHTQIPG---WFSLVAPNRRSNRTMRLSDFLDRTETIR-------LLDTSDNFDALLRGLATQL 453
            :..|:...   ||..|..:        :::: |:|..|.       :.:..|...||:..:....
plant   756 FWVTREQASFDWFKGVMDD--------IAEY-DKTHVIEMHNYLTSMYEAGDARSALIAMVQKLQ 811

  Fly   454 HKRSDGNI--DREIKHYFNRKEFEEYGSDLKS 483
            |.::..:|  :..|:.:|.|..:.:..|:|.|
plant   812 HAKNGVDIVSESRIRTHFARPNWRKVFSELSS 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4009NP_650588.2 An_peroxidase 95..617 CDD:460804 45/227 (20%)
AT5G60010NP_200809.4 NADPH_Ox 97..198 CDD:462469
EF-hand_7 197..269 CDD:463900
COG4097 392..>712 CDD:443273 22/85 (26%)
NOX_Duox_like_FAD_NADP 559..886 CDD:99783 45/227 (20%)
NAD_binding_6 690..868 CDD:429792 27/163 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.