DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and nox1

DIOPT Version :10

Sequence 1:NP_650588.2 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001095857.2 Gene:nox1 / 555604 ZFINID:ZDB-GENE-070404-1 Length:564 Species:Danio rerio


Alignment Length:106 Identity:24/106 - (22%)
Similarity:38/106 - (35%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 YVNDYDETVNPAAYAEFS------AAAFRYAHTQIPGWFSLVAPNRRSNRTMRLSDFLDRTETIR 434
            |:..:|::....|...|.      ....:..|...|.|.......|:.|.:..:..||...:   
Zfish   473 YLTGWDQSHADHAMVHFDKDTDIITGLKQKTHYGRPNWDKEFEQVRQENPSSVVGTFLCGPQ--- 534

  Fly   435 LLDTSDNFDALLRGLATQLHKRSDGNID-REIKHYFNRKEF 474
                     ||.:.|..:..|.||  :| |..|.|||::.|
Zfish   535 ---------ALAKDLEKKCVKYSD--VDPRRTKFYFNKENF 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4009NP_650588.2 An_peroxidase 95..617 CDD:460804 24/106 (23%)
nox1NP_001095857.2 None

Return to query results.
Submit another query.