DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and Ptgs2

DIOPT Version :9

Sequence 1:NP_001262655.1 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_058928.3 Gene:Ptgs2 / 29527 RGDID:620349 Length:604 Species:Rattus norvegicus


Alignment Length:399 Identity:91/399 - (22%)
Similarity:160/399 - (40%) Gaps:85/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LDLSSIYGNNPSQNRKVRLFKGGLLKTSYTNGQHWLPVSQNENGECGAKSECYIVPDIRN--RFS 299
            :||:.:||....:..|:|||:.|.||.....|:.:.|..::      .:.:....|.:..  ||:
  Rat   214 VDLNHVYGETLDRQHKLRLFQDGKLKYQVIGGEVYPPTVKD------TQVDMIYPPHVPEHLRFA 272

  Fly   300 ---------PTIALLQTLLVREHNRLAENLALINPDHSDERIFQEARKINIAQFQKITYYDWLPL 355
                     |.:.:..|:.:|||||:.:.|...:|:..|||:||.:|.|.|.:..||...|::  
  Rat   273 VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYV-- 335

  Fly   356 FVGRTYTYLNGLIYPV--EPTEYVNDYDETVNPAAYAEFSAAAFRYAHTQIPGWFSLVAPNRRSN 418
                  .:|:|..:.:  :|....|...:..|..| :||:  ...:.|..:|..|::      .:
  Rat   336 ------QHLSGYHFKLKFDPELLFNQQFQYQNRIA-SEFN--TLYHWHPLLPDTFNI------ED 385

  Fly   419 RTMRLSDFLDRTETI---RLLDTSDNFDALLRG---------LATQLHKRSDGNIDREIKHYFNR 471
            :......||.....:   .|....::|...:.|         :|.|...::..:..||:|:    
  Rat   386 QEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKY---- 446

  Fly   472 KEFEEYGSDLKSIDIQRARDFGLASYNDVREFCGLRRAVDWADFAHEIPGEKISLLRRLYATPDD 536
                      :|::..|.| |.|..|....|..|.:              |..:.|:.||...|.
  Rat   447 ----------QSLNEYRKR-FSLKPYTSFEELTGEK--------------EMAAELKALYHDIDA 486

  Fly   537 VELGVGGTLEYHVPDALFGPTLLCVIGKQF-LNTRRGDRF----FFERENEGGFSRAQLAEIRKV 596
            :||.....:|...|||:||.|:: .:|..| |....|:..    :::....||  ......|...
  Rat   487 MELYPALLVEKPRPDAIFGETMV-ELGAPFSLKGLMGNPICSPQYWKPSTFGG--EVGFRIINTA 548

  Fly   597 SLSSLFCSN 605
            |:.||.|:|
  Rat   549 SIQSLICNN 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4009NP_001262655.1 An_peroxidase_like 77..>367 CDD:265428 37/140 (26%)
An_peroxidase 95..610 CDD:281139 91/399 (23%)
peroxinectin_like 228..605 CDD:188655 90/397 (23%)
Ptgs2NP_058928.3 EGF 21..53 CDD:278437
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 91/399 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.