DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and Ptgs1

DIOPT Version :9

Sequence 1:NP_001262655.1 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_058739.4 Gene:Ptgs1 / 24693 RGDID:3439 Length:602 Species:Rattus norvegicus


Alignment Length:420 Identity:98/420 - (23%)
Similarity:171/420 - (40%) Gaps:83/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LDLSSIYGNNPSQNRKVRLFKGGLLKTSYTNGQHWLPVSQNEN------------GECGAKSECY 289
            :||..|||::..:...:||||.|.||....:|:.:.|..:..:            .:.....|.:
  Rat   230 VDLGHIYGDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVF 294

  Fly   290 IVPDIRNRFSPTIALLQTLLVREHNRLAENLALINPDHSDERIFQEARKINIAQFQKITYYDWLP 354
                   ...|.:.|..|:.:|||||:.:.|...:|...||::||..|.|.|.:..||...::: 
  Rat   295 -------GLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYV- 351

  Fly   355 LFVGRTYTYLNGLIYPVEPTEYVNDYD-ETVNPAAYAEFSAAAFRYAHTQIPGWFSLVAPN-RRS 417
                   .:|:|....::       :| |.:..|.:...:..|..:.|  :..|..|:..: :..
  Rat   352 -------QHLSGYFLQLK-------FDPELLFRAQFQYRNRIALEFNH--LYHWHPLMPDSFQVG 400

  Fly   418 NRTMRLSDFLDRTETIRLLDTSDNFDALLRGLATQLHKRSDG--NIDREIKHYFNRKEFEEYGSD 480
            ::......||..|.  .|:|.  ..:||:...:.|...|..|  |.|..:.|         ...|
  Rat   401 SQEYSYEQFLFNTS--MLVDY--GVEALVDAFSRQRAGRIGGGRNFDYHVLH---------VAED 452

  Fly   481 LKSIDIQRARDFGLASYNDVREFCGLRRAVDWADFAHEIPGEKISLLRRLYATPDDVELGVGGTL 545
            :    |:.:|:..|.|:|:.|:..||:....:.:|..|  .|..:.|..||...|.:|...|..|
  Rat   453 V----IKESREMRLQSFNEYRKRFGLKPYTSFQEFTGE--KEMAAELEELYGDIDALEFYPGLML 511

  Fly   546 EYHVPDALFGPTLLCVIGKQF-LNTRRGDRF----FFERENEG---GFSRAQLAEIRKVSLSSLF 602
            |...|::|||.::: .:|..| |....|:..    :::....|   ||:....|.::|     |.
  Rat   512 EKCQPNSLFGESMI-EMGAPFSLKGLLGNPICSPEYWKPSTFGGDVGFNIVNTASLKK-----LV 570

  Fly   603 CSNAN---YLHLIQP-------NVFVFPNS 622
            |.|..   |:....|       :|||.|::
  Rat   571 CLNTKTCPYVSFRVPDYPGDDGSVFVRPST 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4009NP_001262655.1 An_peroxidase_like 77..>367 CDD:265428 35/141 (25%)
An_peroxidase 95..610 CDD:281139 93/399 (23%)
peroxinectin_like 228..605 CDD:188655 91/391 (23%)
Ptgs1NP_058739.4 EGF_CA 35..72 CDD:238011
prostaglandin_endoperoxide_synthase 92..578 CDD:188648 92/396 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.