DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and PXDNL

DIOPT Version :9

Sequence 1:NP_001262655.1 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_653252.4 Gene:PXDNL / 137902 HGNCID:26359 Length:1463 Species:Homo sapiens


Alignment Length:699 Identity:206/699 - (29%)
Similarity:297/699 - (42%) Gaps:167/699 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IRPGVSDG-SLDALIKEFMPKYNGNNVHNSWAEPSA-----------SQQPLRCGVPPRNCLNDT 90
            ||..|..| ::|...|||.        :|....|.:           :::||      .||.|..
Human   672 IRERVKQGLTVDLEGKEFR--------YNDLVSPRSLSLIANLSGCTARRPL------PNCSNRC 722

  Fly    91 RNLHYRTLDGSCNNLLYPEFGIAVSRYRRLLPP--RQVEQAPNARLISLSLYGEQ---------- 143
            .:..||..||:||||..|.:|.|::.:.|||.|  |...:||  |.:.|.:...|          
Human   723 FHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAP--RGLGLPVGSRQPLPPPRLVAT 785

  Fly   144 -------TRNDRFRTMAAMQWGQFVAHDISQ----LST----QGAPQDCCAE--PRHPRCLPINL 191
                   ...|...|...|.||.|:.||:..    |||    .|.|   |:.  ...|.|.|:|.
Human   786 VWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRP---CSSVCTNDPPCFPMNT 847

  Fly   192 PRGGPIAYHTGKTCLHFARSVSDADAICPKVEEPQP----------EKLTVATAYLDLSSIYGNN 246
            ....|...|.  .|:.||||       .|.....:|          |::...|||:|.|::||::
Human   848 RHADPRGTHA--PCMLFARS-------SPACASGRPSATVDSVYAREQINQQTAYIDGSNVYGSS 903

  Fly   247 PSQNRKVR--LFKGGLLKTSY---TNGQHWLPVSQNENGECG---AKSECYIVPDIRNRFSPTIA 303
            ..:::.:|  ....|||||.:   .:|:..||.|.....||.   .:|.|::..|.|......:|
Human   904 ERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEHLALA 968

  Fly   304 LLQTLLVREHNRLAENLALINPDHSDERIFQEARKINIAQFQKITYYDWLPLFVGRTYT-YLNGL 367
            .:.||..|||||:|..|:.:||......::||||||..|:.|.|||..|||..:|...| .|.| 
Human   969 AMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRG- 1032

  Fly   368 IYPVEPTEYVNDYDETVNPAAYAEFSAAAFRYAHT-------------------QIPGWFSLVAP 413
                     ...|:..||......|:.||||:.||                   .:|...:|.:|
Human  1033 ---------YRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLPFHKALFSP 1088

  Fly   414 NRRSNRTMRLSDFLDRTETIRLLDTSDNFDALLRGL---ATQLHKRSDGNIDREIKHYFNRKEFE 475
            :|                    :......|.:||||   |.:....|          |....|..
Human  1089 SR--------------------IIKEGGIDPVLRGLFGVAAKWRAPS----------YLLSPELT 1123

  Fly   476 E------YGS--DLKSIDIQRARDFGLASYNDVREFCGLRRAVDWADFAHEIPGEKI-SLLRRLY 531
            :      |.:  |..:..|||.||.|:..|.|.|.||.|....::.|..:||...:| ..||:||
Human  1124 QRLFSAAYSAAVDSAATIIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLY 1188

  Fly   532 ATPDDVELGVGGTLEYHVPDALFGPTLLCVIGKQFLNTRRGDRFFFERENEGGFSRAQLAEIRKV 596
            .:|.|::|.....:|..:|....||||:|:...||...|.||||::  ||.|.|:.|||.::::.
Human  1189 GSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWY--ENPGVFTPAQLTQLKQA 1251

  Fly   597 SLSSLFCSNANYLHLIQPNVFV---FPNSHNLLLNCNFIPQIDLSKWQD 642
            |||.:.|.|.:.:..:|.:|||   :|..:   |||:.||::||..|||
Human  1252 SLSRVLCDNGDSIQQVQADVFVKAEYPQDY---LNCSEIPKVDLRVWQD 1297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4009NP_001262655.1 An_peroxidase_like 77..>367 CDD:265428 105/337 (31%)
An_peroxidase 95..610 CDD:281139 176/593 (30%)
peroxinectin_like 228..605 CDD:188655 127/416 (31%)
PXDNLNP_653252.4 LRR 1 51..72
leucine-rich repeat 52..85 CDD:275378
LRR_8 53..134 CDD:316378
LRR 2 75..96
leucine-rich repeat 86..123 CDD:275378
LRR 3 99..120
LRR_8 123..182 CDD:316378
LRR 4 123..144
leucine-rich repeat 124..147 CDD:275378
LRR 5 147..168
leucine-rich repeat 148..171 CDD:275378
leucine-rich repeat 172..184 CDD:275378
LRRCT 180..232 CDD:214507
Ig_3 234..309 CDD:316449
Ig_3 329..402 CDD:316449
Ig 432..505 CDD:325142
Ig 528..596 CDD:325142
peroxidasin_like 851..1286 CDD:188658 145/488 (30%)
VWC 1400..1450 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 1 1.000 - - FOG0000202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.