DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5225 and cited4a

DIOPT Version :9

Sequence 1:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001038447.2 Gene:cited4a / 562291 ZFINID:ZDB-GENE-030131-7661 Length:240 Species:Danio rerio


Alignment Length:230 Identity:55/230 - (23%)
Similarity:70/230 - (30%) Gaps:96/230 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 HGGHGGHHH---PGHNYPGPYPPPYPPHHPH----DGGDKGYHHYPPHNH--------------- 363
            ||..||..|   .|.|.|.|:     .|.|.    ..|...::...|.|.               
Zfish    11 HGSAGGGLHGYRMGMNGPSPH-----GHQPSLRTLPNGQLMHYSRGPQNSMEVAMRQRNAMNGIM 70

  Fly   364 ----GGHNHGGHNNHHPPHNGEH------NHNHPPHNHGGHGHHHPSHNHGGQDPHNTHPHTGTH 418
                .|...|||     ||..:.      :.|..|..|....|||       ..|.|.||.. ..
Zfish    71 NSQVNGQMSGGH-----PHQMQQANMMYASPNQQPQGHPQSQHHH-------MHPQNQHPQQ-YM 122

  Fly   419 GNGG-----------HSQ---TSHHQHP------HH-----HQPKPTKPEG--SGEQTPR----- 451
            |:||           |.|   |.:|.||      ||     |:..|.:..|  .|...|.     
Zfish   123 GSGGLSASQQLMASMHFQKLNTPYHGHPLGPMNGHHMGNVQHRMGPAQLAGMQMGMGGPALGHNV 187

  Fly   452 DDLDLLDENV--------------EIVENIIDEND 472
            .|:||:||.|              |:.|..:.:|:
Zfish   188 MDIDLIDEEVLTSLVLELGLDRVQELPELFLGQNE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5225NP_650587.1 None
cited4aNP_001038447.2 CITED 1..240 CDD:282356 55/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.