powered by:
Protein Alignment CG5225 and C54D2.1
DIOPT Version :9
Sequence 1: | NP_650587.1 |
Gene: | CG5225 / 42053 |
FlyBaseID: | FBgn0038468 |
Length: | 594 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001360717.1 |
Gene: | C54D2.1 / 183776 |
WormBaseID: | WBGene00016915 |
Length: | 388 |
Species: | Caenorhabditis elegans |
Alignment Length: | 99 |
Identity: | 27/99 - (27%) |
Similarity: | 32/99 - (32%) |
Gaps: | 38/99 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 PSAETGRLIASLQAAPA-PAPA-----------------QSVIY-----------KLPPQHYYPP 57
|||.:...:..:...|| .||| |.|:| .|||.|..|.
Worm 69 PSAASAAAVNGVYQVPAGVAPATFRTVYTDALTAVRPVYQPVVYYPQVVRTPIACALPPCHEVPV 133
Fly 58 PPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQ 91
|.|.| ..|....|..|..|| ||.|:
Worm 134 PVPVP--------TAPATVAPTAPTDLP-TPAPE 158
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5225 | NP_650587.1 |
None |
C54D2.1 | NP_001360717.1 |
EB |
<171..210 |
CDD:366756 |
|
EB |
336..383 |
CDD:366756 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.