DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5225 and C54D2.1

DIOPT Version :9

Sequence 1:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001360717.1 Gene:C54D2.1 / 183776 WormBaseID:WBGene00016915 Length:388 Species:Caenorhabditis elegans


Alignment Length:99 Identity:27/99 - (27%)
Similarity:32/99 - (32%) Gaps:38/99 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSAETGRLIASLQAAPA-PAPA-----------------QSVIY-----------KLPPQHYYPP 57
            |||.:...:..:...|| .|||                 |.|:|           .|||.|..|.
 Worm    69 PSAASAAAVNGVYQVPAGVAPATFRTVYTDALTAVRPVYQPVVYYPQVVRTPIACALPPCHEVPV 133

  Fly    58 PPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQ 91
            |.|.|        ..|....|..|..|| ||.|:
 Worm   134 PVPVP--------TAPATVAPTAPTDLP-TPAPE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5225NP_650587.1 None
C54D2.1NP_001360717.1 EB <171..210 CDD:366756
EB 336..383 CDD:366756
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.