DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdSL and Fum4

DIOPT Version :9

Sequence 1:NP_650586.2 Gene:AdSL / 42051 FlyBaseID:FBgn0038467 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_723527.1 Gene:Fum4 / 318995 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster


Alignment Length:345 Identity:67/345 - (19%)
Similarity:125/345 - (36%) Gaps:46/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VHVFAKQCPSAAPV-----IHLGATSCYVGDNTDLIVLRDALKL-----LLPRVASVIARLSQFA 141
            :.:...|..|..||     :::..:|    .:|....:|.|:.:     |.|.:.:.|..|.:.:
  Fly   137 IEILGGQMGSKEPVDPNEHVNMAQSS----HDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKS 197

  Fly   142 QSYKDQPTLGFTHLQPAQLTTVGKRACLWIQDLIMDERALSRCLEDLRFRGVKGTT-GTQASFLQ 205
            ..:.|...:|.|||..|...::|:....:.|.|:.....|...:..|....:.||: ||:..   
  Fly   198 NDWMDLIKIGRTHLMDAVPLSLGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVD--- 259

  Fly   206 LFNGDGEKVKQLDQLVTELAGFKKAYAVTGQTYSRKVD-----VEIVAALASLGTTIHKMCSDLR 265
                  .|.:...|.:..:|.......|....:...:.     ||:...|.::..::.|:.:|:|
  Fly   260 ------TKAEYSAQCIKRIAELTFLPFVESPNFFESISACDCLVELHGELNTIAASVMKIANDIR 318

  Fly   266 ILASRK-----ELEEPFESTQIGSSAMPYKRNPMRSE---RCCA--LARHLITLFSSAANTHATQ 320
            .|.|..     ||..|  ..:.|||.||.|.||.:.|   ..||  :..|:......::......
  Fly   319 FLGSGPRCGFGELHLP--ENEPGSSIMPGKVNPTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLN 381

  Fly   321 WLERTLDDSANRRLTLSEAFLAADAALLTLLNISQGLVVYPKVIERHISQELPFMSTENIIMAMV 385
            .....:..:..|.:|     |..|.......|..:|:......|...:.:.|..::..:..:...
  Fly   382 TFMPMIASNVLRSIT-----LLGDGMKSFCTNCLEGIEPNRSKIGSIVKESLMLVTALSPHIGYE 441

  Fly   386 KAGGDRQVCHEKIRVLSQEA 405
            ::....:..|.....|.|||
  Fly   442 RSAAIAKAAHHNGTTLEQEA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdSLNP_650586.2 PurB 12..458 CDD:223094 67/345 (19%)
Adenylsuccinate_lyase_2 12..447 CDD:176471 67/345 (19%)
Fum4NP_723527.1 fumC 22..483 CDD:234779 67/345 (19%)
Fumarase_classII 24..480 CDD:176465 67/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.