DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdSL and Fum1

DIOPT Version :9

Sequence 1:NP_650586.2 Gene:AdSL / 42051 FlyBaseID:FBgn0038467 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_572339.1 Gene:Fum1 / 31605 FlyBaseID:FBgn0286222 Length:495 Species:Drosophila melanogaster


Alignment Length:307 Identity:70/307 - (22%)
Similarity:122/307 - (39%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ALKL---LLPRVASVIARLSQFAQSYKDQPTLGFTHLQPAQLTTVGKRACLWIQDLIMDERALSR 183
            ||:|   |.|.:.::...|...::.:||...:|.||...|...|:|:....:.|.|...:..:..
  Fly   185 ALELNNNLKPAIKTLHDALRAKSEEFKDIIKIGRTHTMDAVPLTLGQEFSGYAQQLAYAQERIDA 249

  Fly   184 CLE---DLRFRGVKGTTG--TQASFLQLFNGDGEKVKQLDQL--VTELAGFKKAYAVTGQTYSRK 241
            ||.   :|...|....||  |:..|.:..   ..|:.:|..|  ||....|:...|       |.
  Fly   250 CLPRVYELALGGTAVGTGLNTRKGFAEKC---AAKIAELTSLPFVTAPNKFEALAA-------RD 304

  Fly   242 VDVEIVAALASLGTTIHKMCSDLRILASRK-----ELEEPFESTQIGSSAMPYKRNPMRSERCCA 301
            ..||:...|.::..::.|:.:|:|.|.|..     ||..|  ..:.|||.||.|.||.:.|....
  Fly   305 AMVEVHGVLNTIAVSLMKIANDIRFLGSGPRCGLGELSLP--ENEPGSSIMPGKVNPTQCESLTM 367

  Fly   302 LARHL----ITLFSSAANTHATQWLERTLDDSANRRLTLSEAF----LAADAALLTLLNISQGLV 358
            |:..:    :.:....:|.|        .:.:..:.|.:|...    |.:|.:.....|...|:.
  Fly   368 LSAQVMGNQVAVTIGGSNGH--------FELNVFKPLIVSNVLRSIRLLSDGSRTFTANCVNGIQ 424

  Fly   359 VYPKVIERHISQELPFMSTENIIMAMVKAGGDRQVCHEKIRVLSQEA 405
            ...:.|.:.:::.|..::..|..:...||....:..|:....|.:||
  Fly   425 ANRENIAKIMNESLMLVTALNPHIGYDKAAKIAKTAHKNGTTLKEEA 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdSLNP_650586.2 PurB 12..458 CDD:223094 70/307 (23%)
Adenylsuccinate_lyase_2 12..447 CDD:176471 70/307 (23%)
Fum1NP_572339.1 fumC 31..495 CDD:234779 70/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.