DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8907 and Nck1

DIOPT Version :9

Sequence 1:NP_001247146.1 Gene:CG8907 / 42050 FlyBaseID:FBgn0038466 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_035008.2 Gene:Nck1 / 17973 MGIID:109601 Length:377 Species:Mus musculus


Alignment Length:260 Identity:57/260 - (21%)
Similarity:88/260 - (33%) Gaps:96/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 SLKSIVTVCNDIYVDAG-------LPQAV-LNPLLRRE-TIAFLNGTLDSNEMQLWQSLGPNWTV 367
            |:....:..:|.:||.|       :|..| .|.:..|| .::.:.||    ::.:.:.....|  
Mouse    85 SVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGT----KVIVMEKCSDGW-- 143

  Fly   368 PKDQFKDHKSSYHPIFYDDWSPDWVVDEEVPYLAPALKKSTTPSPVPVPMPPSPGLGNRTWLSRL 432
                   .:.||:...  .|.|...|.||                     ..|| ||:     .:
Mouse   144 -------WRGSYNGQI--GWFPSNYVTEE---------------------GDSP-LGD-----HV 172

  Fly   433 ESRNVKIAEVTFNK---------------SATNDKELKVTKGEYLEIIDDSRN---WWKARNSYG 479
            .|.:.|:|.|..|.               |::||:||...||:.:::|:...|   |||.|...|
Mouse   173 GSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKING 237

  Fly   480 NIGYVPHTVLT---------------------------PYNFEPGVNGRDTESLASMALTENGGE 517
            .:|.||...:|                           .:...|...|:.|...|.|||.|.|.|
Mouse   238 MVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHE 302

  Fly   518  517
            Mouse   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8907NP_001247146.1 PTB_EPS8 43..175 CDD:269921
SH3_Eps8 439..492 CDD:212698 21/97 (22%)
SAM_superfamily 635..699 CDD:301707
Nck1NP_035008.2 SH3_Nck1_1 3..61 CDD:212833
SH3_Nck1_2 108..162 CDD:212834 13/68 (19%)
SH3_Nck1_3 193..249 CDD:212837 17/55 (31%)
SH2_Nck1 280..376 CDD:198271 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.