DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and YHR140W

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_012009.1 Gene:YHR140W / 856543 SGDID:S000001182 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:19/95 - (20%)
Similarity:38/95 - (40%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 NRALEVSNEFAVAAIRFYFSMLPNELLNLTKDNVVYGTEKNNQYVFISKELPTKNLFE-LKEEIY 505
            |.|:.:||        :|...  |..:||.       |:|.:.::.....||...:.| :...:|
Yeast    58 NNAVNISN--------YYIQR--NNKMNLE-------TKKKSDFISRHVTLPVSLVLESIVATVY 105

  Fly   506 KP-KLQYTSQKLNNILESLLNQETMKMDAA 534
            .| :|.:.:..::.:..:......|.:|.|
Yeast   106 WPLRLFFVNLIMHGVESTAKTPFPMTVDMA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 19/95 (20%)
An_peroxidase_like 290..637 CDD:265428 19/95 (20%)
YHR140WNP_012009.1 Far-17a_AIG1 <83..220 CDD:368096 9/53 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.