DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and PTGS2

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_000954.1 Gene:PTGS2 / 5743 HGNCID:9605 Length:604 Species:Homo sapiens


Alignment Length:348 Identity:75/348 - (21%)
Similarity:135/348 - (38%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LDLSQLYGFTAAAERKLRVLEGGLLR-STPRGEFDNALLPIATDTEGPSFCARATIGDGTCFAAG 363
            :||:.:||.|.|.:||||:.:.|.:: ....||.   ..|...||:. .......:.:...||.|
Human   214 VDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEM---YPPTVKDTQA-EMIYPPQVPEHLRFAVG 274

  Fly   364 DSRVNSSPFSILIYTIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEVL 428
            .......|..::..||::|.||:|...|||.:|.|.||:|||.::.:.:....::|||:::..:.
Human   275 QEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLS 339

  Fly   429 GQ----KMSSEIRRKQPNRALEVSNEFAVA--AIRFYFSMLPNELLNLTKDNVVYGTEKNNQYVF 487
            |.    |...|:..   |:..:..|..|..  .:..:..:||:..                    
Human   340 GYHFKLKFDPELLF---NKQFQYQNRIAAEFNTLYHWHPLLPDTF-------------------- 381

  Fly   488 ISKELPTKNLFELKEEIYKPKLQYTSQKLNN--ILESLLNQETMKMDAAYSGGVVWHKDTKPTHA 550
                           :|:..|..|.....||  :||..:.|.........:|.|...::..|...
Human   382 ---------------QIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQ 431

  Fly   551 DILAFDIQRGRDHGLLPYYRYLESCVLSRPVESWKDFEHFIPSDVLDKLKTIYASWADVDLIVGG 615
            .:....|.:.|......:..|.:..:| :|.||:::...  ..::..:|:.:|.....|:|....
Human   432 KVSQASIDQSRQMKYQSFNEYRKRFML-KPYESFEELTG--EKEMSAELEALYGDIDAVELYPAL 493

  Fly   616 ISENP----VHG----SIGPTFS 630
            :.|.|    :.|    .:|..||
Human   494 LVEKPRPDAIFGETMVEVGAPFS 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 75/348 (22%)
An_peroxidase_like 290..637 CDD:265428 75/348 (22%)
PTGS2NP_000954.1 EGF_CA 19..54 CDD:238011
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 75/348 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.