DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and PTGS1

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_000953.2 Gene:PTGS1 / 5742 HGNCID:9604 Length:599 Species:Homo sapiens


Alignment Length:604 Identity:121/604 - (20%)
Similarity:212/604 - (35%) Gaps:159/604 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 RNGFYQMFPNSGRRETVPAAWSISKELYEPD----HIQISKQQTFESNSNLALPQWAQFVEHDLS 224
            |.|:      ||...|:|..|:..:....|.    |..::..:.|....|      |.|:...|.
Human    60 RTGY------SGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVN------ATFIREMLM 112

  Fly   225 KPVSQSMSN---GAPIECCSRDQINLQPRHH----------HPACAPILYQPGGKYDVPSCLNYV 276
            :.|....||   ..|....:.|.|:.:...:          .|...|......||..:|......
Human   113 RLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLA 177

  Fly   277 RSAL----------------AVADCNFGGAEQLNQATGSL------------DLSQLYGFTAAAE 313
            |..|                |....:|  ..|..:.:|.:            ||..:||.....:
Human   178 RRFLLRRKFIPDPQGTNLMFAFFAQHF--THQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ 240

  Fly   314 RKLRVLEGGLLRSTPRGEFDNALLPIATDTEGPSFCARAT-IGDGTCFAAGDSRVNSSPFSILIY 377
            .:||:.:.|.|:..   ..|..:.|.:.: |.|....... |...:..|.|.......|..:|..
Human   241 YQLRLFKDGKLKYQ---VLDGEMYPPSVE-EAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYA 301

  Fly   378 TIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEVLGQKMSSEIRRKQPN 442
            |:::|.||:|...||..:|.|.||:|||..:.:.:....::||||::.::.|..:..:.   .|.
Human   302 TLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF---DPE 363

  Fly   443 RALEVSNEFAVAAIRFYFSMLPNELLN---LTKDNVVYGTEKNNQYVFISKELPTKNLFELKEEI 504
            ....|..::     |...:|..|.|.:   |..|:...|::                     |..
Human   364 LLFGVQFQY-----RNRIAMEFNHLYHWHPLMPDSFKVGSQ---------------------EYS 402

  Fly   505 YKPKLQYTSQKLNNILESLLNQETMKMDAAYSGGVVWHKDTKPTHADILAFD-IQRGRDHGLLPY 568
            |:..|..||..::..:|:|::..:.::.....||  .:.|....|   :|.| |:..|:..|.|:
Human   403 YEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGG--RNMDHHILH---VAVDVIRESREMRLQPF 462

  Fly   569 YRYLESCVLSRPVESWKDFEHFI-PSDVLDKLKTIYASWADVD-------LIVGGISENPVHG-- 623
            ..|.:...: :|..|   |:..: ..::..:|:.:|   .|:|       |::.....|.:.|  
Human   463 NEYRKRFGM-KPYTS---FQELVGEKEMAAELEELY---GDIDALEFYPGLLLEKCHPNSIFGES 520

  Fly   624 --SIGPTFSC-------IISEQF-----------VHVLKQNQQKAVQKHTELVEQYRHFNGTKLL 668
              .||..||.       |.|.::           .:::|....|                  ||:
Human   521 MIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLK------------------KLV 567

  Fly   669 CLNSGLSAVPQNIFQLPSA 687
            |||:  ...|...|::|.|
Human   568 CLNT--KTCPYVSFRVPDA 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 116/587 (20%)
An_peroxidase_like 290..637 CDD:265428 81/382 (21%)
PTGS1NP_000953.2 EGF_CA 32..69 CDD:238011 4/14 (29%)
prostaglandin_endoperoxide_synthase 89..575 CDD:188648 109/558 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.