DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and ptgs2b

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001020675.1 Gene:ptgs2b / 559020 ZFINID:ZDB-GENE-041014-323 Length:606 Species:Danio rerio


Alignment Length:344 Identity:72/344 - (20%)
Similarity:140/344 - (40%) Gaps:72/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LDLSQLYGFTAAAERKLRVLEGGLLR-STPRGE-FDNALLPIATDTEGPSFCARATIGDGTCFAA 362
            :||:.:||.....:.|||:.:.|.|| ....|| :...:..:..|...|..     :.:...||.
Zfish   216 VDLAHIYGQNLDRQHKLRLFKDGKLRYQILDGEVYPPTVSEVQVDMHYPPH-----VPESRRFAV 275

  Fly   363 GDSRVNSSPFSILIYTIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEV 427
            |.......|..::..||::|.||:|...|||.:|.|.||:|||.::.:.:....::|||:::..:
Zfish   276 GHEAFGLVPGLMMYATIWLREHNRVCDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHL 340

  Fly   428 LGQ----KMSSEI----RRKQPNRALEVSNEFAVAAIRFYFSMLPNELLNLTKDNVVYGTEKNNQ 484
            .|.    |...|:    |.:..||   :|:||  ..:..:..::|::                  
Zfish   341 SGYYFKLKFDPELLFNERFQYQNR---ISSEF--NTLYHWHPLMPDD------------------ 382

  Fly   485 YVFISKELPTKNLFELKEEIYKPKLQY-------TSQKLNNILESLLNQETMKMDAAYSGGVVWH 542
                         |.:::|:|..: |:       |...:|:::||...|        .:|.|...
Zfish   383 -------------FHIQDEVYNYQ-QFLFNTSILTDYGVNSLVESFNKQ--------IAGRVAGG 425

  Fly   543 KDTKPTHADILAFDIQRGRDHGLLPYYRYLESCVLSRPVESWKDFEHFI-PSDVLDKLKTIYASW 606
            ::..|....:....|:..|.    ..|:.:.:......::.::.||... ..::..:|:.:|...
Zfish   426 RNVAPAVLRVAIKSIENSRQ----MRYQSINAYRKRFNMKPYRSFEEMTGEKEMAAELEEMYGDV 486

  Fly   607 ADVDLIVGGISENPVHGSI 625
            ..|:|..|.:.|.|...:|
Zfish   487 DAVELYAGLLVEKPRSNAI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 72/344 (21%)
An_peroxidase_like 290..637 CDD:265428 72/344 (21%)
ptgs2bNP_001020675.1 EGF_CA 21..57 CDD:238011
prostaglandin_endoperoxide_synthase 77..565 CDD:188648 72/344 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.