DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and Spf45

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster


Alignment Length:172 Identity:34/172 - (19%)
Similarity:59/172 - (34%) Gaps:68/172 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ANSSRDVNAELNRIPASKWL---QYVETALDSVNRQKRLEDNLLGSDITVKNGSLSHAQLLDTLP 85
            |.|...:.:::...|:.|.:   |.|:||.:|.:         :|..||                
  Fly   262 ALSPPSIGSQIGTSPSHKAMPPPQMVDTAAESGD---------IGYSIT---------------- 301

  Fly    86 SLASKKDNKLALKILK--SSLLVFNSECLPNNID-------GDKCRS-YLEQKPLPEGSSLRTEC 140
                        :|:|  |.:::..:...|.::|       .|:|.: |.|...:....|..|..
  Fly   302 ------------EIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHESFGTVP 354

  Fly   141 ENSLKGNREGHYAFRRL--------------LGSSHYRNGFY 168
            |:::|...|    |||:              .|....|.|||
  Fly   355 EDAVKIFVE----FRRIESAIKAVVDLNGRFFGGRQVRAGFY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 8/32 (25%)
An_peroxidase_like 290..637 CDD:265428
Spf45NP_001036426.1 G-patch 209..248 CDD:279867
RRM_UHM_SPF45 307..402 CDD:241091 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.