DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and Ptgs1

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_058739.4 Gene:Ptgs1 / 24693 RGDID:3439 Length:602 Species:Rattus norvegicus


Alignment Length:422 Identity:88/422 - (20%)
Similarity:155/422 - (36%) Gaps:102/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LDLSQLYGFTAAAERKLRVLEGGLLRSTPRGEFDNALLPIATDTEGPSFCARATIG--DGTCFAA 362
            :||..:||.:...:..||:.:.|.|:..   ..|..:.|  ...|..|...|...|  .....|.
  Rat   230 VDLGHIYGDSLERQYHLRLFKDGKLKYQ---VLDGEVYP--PSVEQASVLMRYPPGVPPEKQMAV 289

  Fly   363 GDSRVNSSPFSILIYTIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEV 427
            |.......|..:|..||::|.||:|...||:.:|.|.||:|||..:.:.:....:::|||::..:
  Rat   290 GQEVFGLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHL 354

  Fly   428 LGQ----KMSSEIR-RKQPNRALEVSNEFAVAAIRFYFSMLPNELLN---LTKDNVVYGTEKNNQ 484
            .|.    |...|:. |.|......::.||             |.|.:   |..|:...|::    
  Rat   355 SGYFLQLKFDPELLFRAQFQYRNRIALEF-------------NHLYHWHPLMPDSFQVGSQ---- 402

  Fly   485 YVFISKELPTKNLFELKEEIYKPKLQYTSQKLNNILESLLNQETMKMDAAYSGGVVWHKDTKPTH 549
                             |..|:..|..||..::..:|:|::..:.:......||..:........
  Rat   403 -----------------EYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLHVA 450

  Fly   550 ADILAFDIQRGRDHGLLPYYRYLESCVLSRPVESWKDFEHFIPSDVLDKLKTIYASWADVD---- 610
            .|:    |:..|:..|..:..|.:...| :|..|:::|..  ..::..:|:.:|   .|:|    
  Rat   451 EDV----IKESREMRLQSFNEYRKRFGL-KPYTSFQEFTG--EKEMAAELEELY---GDIDALEF 505

  Fly   611 ---LIVGGISENPVHG----SIGPTFSCIISEQFVHVLKQNQQKAVQKHTELVEQY---RHFNG- 664
               |::.....|.:.|    .:|..||.               |.:..:.....:|   ..|.| 
  Rat   506 YPGLMLEKCQPNSLFGESMIEMGAPFSL---------------KGLLGNPICSPEYWKPSTFGGD 555

  Fly   665 -----------TKLLCLNSGLSAVPQNIFQLP 685
                       .||:|||:  ...|...|::|
  Rat   556 VGFNIVNTASLKKLVCLNT--KTCPYVSFRVP 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 84/407 (21%)
An_peroxidase_like 290..637 CDD:265428 76/357 (21%)
Ptgs1NP_058739.4 EGF_CA 35..72 CDD:238011
prostaglandin_endoperoxide_synthase 92..578 CDD:188648 85/413 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.