DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irc and Igsf9b

DIOPT Version :9

Sequence 1:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:296 Identity:63/296 - (21%)
Similarity:92/296 - (31%) Gaps:114/296 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSHAQLLDTLPSLASKKDNKLALKILKSSLLVFNSECLPNNIDGDKCRSYLEQKPLPEG----SS 135
            |:.|.|..||.:....|..|..||..|...|...           .||..|| .||..|    .|
Mouse   740 LAAAILFSTLAACFVNKQRKRKLKRKKDPPLSIT-----------HCRKSLE-SPLSSGKVSPES 792

  Fly   136 LRTECENSLKGNREGHYAFRRLLGSSHYR------------------------------------ 164
            :||....|...:.:|..|.:|:|..:..:                                    
Mouse   793 IRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSRKYSVAKAEAEAEATTPIELIS 857

  Fly   165 ---NGFYQMFPN------SGRR-ETVPAAWSISKELYEPDHIQISKQQTFESNSNLALPQWAQFV 219
               :|.:.|.|:      .||| |..|.|        |...:....:|:.|.|.:..:|.....:
Mouse   858 RGPDGRFVMGPSEMEPSVKGRRIEGFPFA--------EETDMYPEFRQSDEENEDPLVPTSVAAL 914

  Fly   220 EHDLSKPVSQSMSNGAPIECCSRDQINLQPRHHHPACAPILYQPGGKYDVPSCLNYVRSALAVAD 284
            :..|: |:|.|..:..|                .||.:| .:||.| .:.||.|           
Mouse   915 KPQLT-PMSSSQDSYLP----------------PPAYSP-RFQPRG-LEGPSGL----------- 949

  Fly   285 CNFGGAEQLNQATGS--------LDLSQLYGFTAAA 312
               ||.   .||||.        ....|.||:.:::
Mouse   950 ---GGR---LQATGQARPPAPRPFQHGQYYGYLSSS 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 40/216 (19%)
An_peroxidase_like 290..637 CDD:265428 7/31 (23%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462
Ig 231..323 CDD:386229
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.