DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3a1 and AT1G18050

DIOPT Version :10

Sequence 1:NP_650583.1 Gene:Sf3a1 / 42048 FlyBaseID:FBgn0266917 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001319032.1 Gene:AT1G18050 / 838385 AraportID:AT1G18050 Length:224 Species:Arabidopsis thaliana


Alignment Length:60 Identity:24/60 - (40%)
Similarity:33/60 - (55%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPEVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGN 91
            ||..|...|.:|..|...|||.|.::..:..||||::|....|.|||||:.|:..:|..|
plant   147 PPRTRYYADSSARLVFMEGPEMERKMMTSYAGNPKYSFFWSSDRYHAYYQKKLAGYRAQN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3a1NP_650583.1 SWAP 36..89 CDD:197818 20/52 (38%)
Surp 150..200 CDD:460339
PRP21_like_P 228..480 CDD:403444
Ubl_SF3a120 696..777 CDD:340498
AT1G18050NP_001319032.1 SWAP 155..203 CDD:197818 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.