DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3a1 and AT5G06890

DIOPT Version :10

Sequence 1:NP_650583.1 Gene:Sf3a1 / 42048 FlyBaseID:FBgn0266917 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_196306.1 Gene:AT5G06890 / 830579 AraportID:AT5G06890 Length:66 Species:Arabidopsis thaliana


Alignment Length:75 Identity:22/75 - (29%)
Similarity:41/75 - (54%) Gaps:13/75 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 VLVPNSDKSEWKLNGQMIAVTM-ALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFY 764
            |.||:.:      :||:|.:|: :|||.:|:||.|:.::..:   :.|   .|:...|..::|.|
plant     2 VSVPDVN------DGQVIEITVQSLSENVASLKEKVANKLKL---RGK---AGILKDDDKSLAHY 54

  Fly   765 NLVNGTTVHL 774
            |:..|..:.|
plant    55 NVRAGDILTL 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3a1NP_650583.1 SWAP 36..89 CDD:197818
Surp 150..200 CDD:460339
PRP21_like_P 228..480 CDD:403444
Ubl_SF3a120 696..777 CDD:340498 22/75 (29%)
AT5G06890NP_196306.1 Ubl1_cv_Nsp3_N-like 2..65 CDD:475130 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.