powered by:
Protein Alignment Sf3a1 and AT5G06890
DIOPT Version :9
Sequence 1: | NP_650583.1 |
Gene: | Sf3a1 / 42048 |
FlyBaseID: | FBgn0266917 |
Length: | 784 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_196306.1 |
Gene: | AT5G06890 / 830579 |
AraportID: | AT5G06890 |
Length: | 66 |
Species: | Arabidopsis thaliana |
Alignment Length: | 75 |
Identity: | 22/75 - (29%) |
Similarity: | 41/75 - (54%) |
Gaps: | 13/75 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 701 VLVPNSDKSEWKLNGQMIAVTM-ALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFY 764
|.||:.: :||:|.:|: :|||.:|:||.|:.::..: :.| .|:...|..::|.|
plant 2 VSVPDVN------DGQVIEITVQSLSENVASLKEKVANKLKL---RGK---AGILKDDDKSLAHY 54
Fly 765 NLVNGTTVHL 774
|:..|..:.|
plant 55 NVRAGDILTL 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0007 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1256232at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.