DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3a1 and AT5G06890

DIOPT Version :9

Sequence 1:NP_650583.1 Gene:Sf3a1 / 42048 FlyBaseID:FBgn0266917 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_196306.1 Gene:AT5G06890 / 830579 AraportID:AT5G06890 Length:66 Species:Arabidopsis thaliana


Alignment Length:75 Identity:22/75 - (29%)
Similarity:41/75 - (54%) Gaps:13/75 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 VLVPNSDKSEWKLNGQMIAVTM-ALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFY 764
            |.||:.:      :||:|.:|: :|||.:|:||.|:.::..:   :.|   .|:...|..::|.|
plant     2 VSVPDVN------DGQVIEITVQSLSENVASLKEKVANKLKL---RGK---AGILKDDDKSLAHY 54

  Fly   765 NLVNGTTVHL 774
            |:..|..:.|
plant    55 NVRAGDILTL 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3a1NP_650583.1 SWAP 36..89 CDD:197818
Surp 150..200 CDD:280053
PRP21_like_P 227..479 CDD:289034
SF3a120_C 709..784 CDD:176395 19/67 (28%)
UBQ 713..777 CDD:214563 19/63 (30%)
AT5G06890NP_196306.1 Ubiquitin_like_fold 2..65 CDD:421700 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256232at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.