DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3a1 and AT4G16200

DIOPT Version :9

Sequence 1:NP_650583.1 Gene:Sf3a1 / 42048 FlyBaseID:FBgn0266917 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_193355.1 Gene:AT4G16200 / 827313 AraportID:AT4G16200 Length:288 Species:Arabidopsis thaliana


Alignment Length:284 Identity:79/284 - (27%)
Similarity:113/284 - (39%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATLDAEANEEQFGNDQPKSMSGPIIGIIYPPPEV--RNIVDKTASFVARNGPEFEARIRQNELGN 64
            :||.:|.:.|                ||.||.::  |.:|||.|.||::.|.|||.:|..:...:
plant     4 STLQSEQSME----------------IITPPADIGTRTLVDKAAQFVSKKGLEFETKIIDSYPTD 52

  Fly    65 PKFNFLNG-GDPYHAYYRHKVNEFREGNDAGITALASMKQL-----AVTSAAQQRQQELLKQVVE 123
            .|||||.. .||.|.||:||:.|:...|..|.|..:.:|..     ..|:|..:....|:.|...
plant    53 AKFNFLRSTADPCHTYYKHKLAEYSSQNQDGATDESDIKIFHAPPNVTTTAIVETTSCLVSQFGS 117

  Fly   124 Q---------------QFVPKEPPPE--------FEFIADP----------PSISAL-------- 147
            :               .|:.....|.        .|:..||          .|||..        
plant   118 EFEMMVKDSNTDDARFNFLKSSEDPYNVLYKQKLDEYSLDPRDAYYQHKLAESISKYHREATPKL 182

  Fly   148 -----------------DLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTK 195
                             :||.||:||||||..|..|...||.|.....||:|::.....|.::.:
plant   183 VLPNLLQFRLVKEMTFEELDTVKVTAQFVAWYGDDFRGFLMERVMTEPQFEFMKATDYRFSFYNE 247

  Fly   196 LLEQYTKVLIPPKDLLGKLRSESA 219
            .:..|::||.|||.|..|||..:|
plant   248 FVVAYSQVLNPPKYLKDKLRGRAA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3a1NP_650583.1 SWAP 36..89 CDD:197818 25/53 (47%)
Surp 150..200 CDD:280053 18/49 (37%)
PRP21_like_P 227..479 CDD:289034
SF3a120_C 709..784 CDD:176395
UBQ 713..777 CDD:214563
AT4G16200NP_193355.1 Surp 25..76 CDD:280053 23/50 (46%)
Surp 104..154 CDD:280053 4/49 (8%)
SWAP 201..254 CDD:197818 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3529
eggNOG 1 0.900 - - E1_KOG0007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1256232at2759
OrthoFinder 1 1.000 - - FOG0003484
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.