DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3a1 and AT2G43960

DIOPT Version :9

Sequence 1:NP_650583.1 Gene:Sf3a1 / 42048 FlyBaseID:FBgn0266917 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_181924.2 Gene:AT2G43960 / 819001 AraportID:AT2G43960 Length:442 Species:Arabidopsis thaliana


Alignment Length:272 Identity:65/272 - (23%)
Similarity:107/272 - (39%) Gaps:80/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPP-----EVRNI-VDKTASFVARNGPEFEARIRQNELG----NPKFNFLNGGDPYHAYYRHKVN 85
            |||     |:|:| :::.:...||.|.|.|.:::...:|    :..|.|..|.|  |..|:.|:.
plant     9 PPPRPDDDELRSIMLERLSIAAARGGLEMEEKLKSRFVGLDIPSCSFVFPKGRD--HHIYKQKIA 71

  Fly    86 EFREGNDAGITALASMKQLAVTSAAQQRQQELLKQVVEQQFVPKEPPPEFEFIADPPSISAL--- 147
            |:.:                  |........|...:|:|..:...|   .|.:|....:||.   
plant    72 EYTK------------------SPPLHSPPPLPPGLVDQCCLKYNP---LEQVAIIDELSAFTVR 115

  Fly   148 ---------DLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTKLLEQYTKV 203
                     :|.|:|.|||||.|.|:.|...|..|...:.:|.||....|...:|:.|...|:.:
plant   116 VPEGGMTRKELGIIKFTAQFVLRYGQYFRLALRDRVSTDTEFKFLDKGDSRAHFFSLLFLGYSHL 180

  Fly   204 L------IPPKDLL--GKLRSESAPGRSSMNQVLEQVKYRANWQRHQEAQRRREEEKIERERVAY 260
            |      :...|:|  |.|        |::|...|:::              .:||.:::     
plant   181 LRAWEYPLVGMDVLVDGFL--------SALNSFKEKLE--------------GDEELVDK----- 218

  Fly   261 AQIDWHDFVVVE 272
            .:.|.|||||.:
plant   219 IKTDRHDFVVCD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3a1NP_650583.1 SWAP 36..89 CDD:197818 16/57 (28%)
Surp 150..200 CDD:280053 18/49 (37%)
PRP21_like_P 227..479 CDD:289034 9/46 (20%)
SF3a120_C 709..784 CDD:176395
UBQ 713..777 CDD:214563
AT2G43960NP_181924.2 SWAP 126..179 CDD:197818 20/52 (38%)
Surp 288..342 CDD:280053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.