DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3534 and XK-1

DIOPT Version :9

Sequence 1:NP_650582.1 Gene:CG3534 / 42047 FlyBaseID:FBgn0038463 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_179732.2 Gene:XK-1 / 816675 AraportID:AT2G21370 Length:478 Species:Arabidopsis thaliana


Alignment Length:255 Identity:54/255 - (21%)
Similarity:97/255 - (38%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SPNSILGNVSPYFVERFSFSPDCKVAASTGDNPSA-LSGMLVGSSWLTISMGTSDTLMMSLKEPL 315
            :|.:.:||:...|..:|.|..||.|...|.|:.:| |:...........|:|:  ||.:.|....
plant   248 APGTSIGNLKESFTRQFGFPDDCIVCTGTTDSIAAFLAARATEPGKAVTSLGS--TLAIKLLSTK 310

  Fly   316 NWEEGH--ILCHPTETEEFMGLLCFRNASLVREEMNKKTTGGDWDKFNEYLDSTPRGNFGNMAVH 378
            ..::..  :..|..:.:..:|.......:::|:..:           :|.|:        .::..
plant   311 RVDDARYGVYSHRLDDKWLVGGASNTGGAILRQLFS-----------DEQLE--------RLSQE 356

  Fly   379 FNDMEIIPKAQGILRWNREMDP-SSPDAARGVIKFSSPQIEIRALVEGQMLHHRAVAEDLGYKFG 442
            .|.|...|.....|:.:.|..| :.|:.|..::......:|   .:.| :|...|..|..|||..
plant   357 INPMVGSPLDYYPLQSSGERFPIADPNLAPRLLPRPESDVE---FLHG-ILESIARIEGKGYKLL 417

  Fly   443 PE------TQILVTGGASVNKSILQTIADVFNAP----VHIQDEGFEAALL---GAAYRS 489
            .|      .::|..||.:.|...::....|...|    || .:..:.|:||   ||...|
plant   418 KELGATEAEEVLTAGGGAKNDKWIKIRQRVLGLPVKKAVH-TEASYGASLLALKGAKQNS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3534NP_650582.1 FGGY_D-XK_euk 10..491 CDD:212660 54/255 (21%)
PLN02669 11..546 CDD:178274 54/255 (21%)
NBD_sugar-kinase_HSP70_actin <447..545 CDD:302596 14/50 (28%)
XK-1NP_179732.2 XylB 54..472 CDD:223996 51/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10196
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.