DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC2A and EMC2

DIOPT Version :9

Sequence 1:NP_001262652.1 Gene:EMC2A / 42046 FlyBaseID:FBgn0038462 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_012621.1 Gene:EMC2 / 853550 SGDID:S000003848 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:63/263 - (23%)
Similarity:103/263 - (39%) Gaps:65/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLI--LEQVIIAALDTARFDIATKCT 74
            |.:..:.|.|:..|.:|.::|.:...:|:    ..||::..|  ||.::                
Yeast    69 DAQVVYNTLRDRLGENSYKMVIMKATLLQ----INGNDKGAIEYLENLL---------------- 113

  Fly    75 KQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILKARGRRL--- 136
             ...||:                     |.|.|....|||          |:..:|...:.|   
Yeast   114 -NDDLEY---------------------ETDFVTYVSIAK----------KLIAIKTTSKNLSQE 146

  Fly   137 EAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVLLHNPHSHLIHQRLAEIRYTMG 201
            ..:||:.....||..|.|.|.....:|...|:|.||.:|:|:||...|.::....||:|..|...
Yeast   147 SVLKEVVALTDKFPLDAELWWYASEIYFEMGQFEKACYCLEQVLCITPFNYACFGRLSETLYYEA 211

  Fly   202 GVENMESARTYYSQALKLNPHNLRA--LYGIYLCCNHLDN--SRAVS-SKRKELQKLSQWALEQL 261
            .....::......:|||   :.||:  |..:||....|.|  ||.:. :|:.:|.|||...|:::
Yeast   212 LRSKKQTKTELLEKALK---NALRSVELSELYLKGWALVNIISRELGRNKQNDLIKLSASKLKEI 273

  Fly   262 LTK 264
            ..|
Yeast   274 SAK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC2ANP_001262652.1 TPR repeat 86..113 CDD:276809 3/26 (12%)
TPR_11 154..221 CDD:290150 19/66 (29%)
TPR repeat 154..181 CDD:276809 10/26 (38%)
TPR repeat 186..219 CDD:276809 6/32 (19%)
EMC2NP_012621.1 TPR repeat 163..191 CDD:276809 10/27 (37%)
TPR repeat 196..236 CDD:276809 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346744
Domainoid 1 1.000 49 1.000 Domainoid score I2945
eggNOG 1 0.900 - - E1_KOG3060
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I1849
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102350
Panther 1 1.100 - - LDO PTHR12760
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R859
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.