DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC2B and oca3

DIOPT Version :9

Sequence 1:NP_001262651.1 Gene:EMC2B / 42045 FlyBaseID:FBgn0038461 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_595921.2 Gene:oca3 / 2539872 PomBaseID:SPBC15C4.01c Length:282 Species:Schizosaccharomyces pombe


Alignment Length:225 Identity:65/225 - (28%)
Similarity:112/225 - (49%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KVHKTGNERHLILEQVIIAALDTARFDIATKCTKQLALEFPGSLRVMKFKAMRYEALEQYDEADE 106
            |:.|..:|...:.::|.||||.|....:|.||..:|...|..|.||.....|..||.....:|..
pombe    28 KLGKYKDEIWDVYQKVFIAALTTGETVLAKKCWNRLNDRFHKSPRVEGLYGMFLEATASEKDAMS 92

  Fly   107 VLDAIIAKDETNAAPRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGK 171
            ..::.:::|.|:....|||:|:|::.|:..|.|:.|..||..|.:|.|||.||.::|::...|..
pombe    93 YYNSKLSEDPTHTVIYKRKLALLRSMGQTKECIQGLINYLDTFYNDLEAWAELADIYVSVEAFES 157

  Fly   172 AAFCMEEVLLHNPHSHLIHQRLAEIRYTM--GGVENMESARTYYSQALKLNPHNLRALYGIYLCC 234
            |.||.||::|..|....:..||.::.:.:  ....|...:..:|.:::::........:||..||
pombe   158 AIFCYEEMVLLQPFEPRLFARLGDLYFVLAQSNATNYWFSLKHYCRSVEICEEYFHGWFGISKCC 222

  Fly   235 NHLDNSRAVSSKRKELQKLSQWALEQLLTK 264
                         ::|.:||:..|::||:|
pombe   223 -------------QQLLELSRTELKRLLSK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC2BNP_001262651.1 TPR repeat 86..113 CDD:276809 6/26 (23%)
TPR_11 154..221 CDD:290150 18/68 (26%)
TPR repeat 154..181 CDD:276809 12/26 (46%)
TPR repeat 186..219 CDD:276809 4/34 (12%)
oca3NP_595921.2 TPR repeat 107..133 CDD:276809 10/25 (40%)
TPR_11 140..207 CDD:290150 18/66 (27%)
TPR repeat 140..167 CDD:276809 12/26 (46%)
TPR repeat 172..207 CDD:276809 4/34 (12%)
TPR repeat 212..238 CDD:276809 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I1917
eggNOG 1 0.900 - - E1_KOG3060
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8785
Inparanoid 1 1.050 96 1.000 Inparanoid score I1695
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003504
OrthoInspector 1 1.000 - - otm47245
orthoMCL 1 0.900 - - OOG6_102350
Panther 1 1.100 - - O PTHR12760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2876
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.