DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL2 and Ahcy

DIOPT Version :9

Sequence 1:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_057870.3 Gene:Ahcy / 269378 MGIID:87968 Length:432 Species:Mus musculus


Alignment Length:423 Identity:216/423 - (51%)
Similarity:298/423 - (70%) Gaps:1/423 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGAT 134
            |..|..:|:||:.::|||:||||:|.:|:.....||||||.|.||.|:..::||||||||.|||.
Mouse     9 VADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGAE 73

  Fly   135 VRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDGGDATHL 199
            |||::|||:|||:..|||:|:||||:|||:|||:||:.||:::.::......|:|||||||.|:|
Mouse    74 VRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNL 138

  Fly   200 MLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSL 264
            :..|||.....||||.||:.||||.||.:...|.|.||||||||||||:|||..|.||:|::|.:
Mouse   139 IHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGI 203

  Fly   265 KRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRT 329
            ||.||:|..||..|:.|||||||||||:|:|.|..|.:||:|||.||||||:|:.|..::|..:.
Mouse   204 KRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKE 268

  Fly   330 VDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDG 394
            .::.||.||..::|...|..:||:..|:||:||...||||..|:...:....::.|||.....:|
Mouse   269 GNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNG 333

  Fly   395 RMIILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSAPGRYKSDVYLLPKKMDEYVASLH 458
            |.||||||||||||.|:. ..|||:|.:.:.|.:|.|||::.|.:|...|:.||||:||.||..|
Mouse   334 RRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAH 398

  Fly   459 LATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491
            |...:..||:||::|::::|:...||||.::||
Mouse   399 LGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYR 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 212/416 (51%)
AdoHcyase 67..491 CDD:283003 214/421 (51%)
AhcyNP_057870.3 AdoHcyase 8..431 CDD:214963 214/421 (51%)
NAD binding. /evidence=ECO:0000250 183..350 84/166 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.