DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL2 and AHCY

DIOPT Version :9

Sequence 1:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001309015.1 Gene:AHCY / 191 HGNCID:343 Length:434 Species:Homo sapiens


Alignment Length:424 Identity:217/424 - (51%)
Similarity:301/424 - (70%) Gaps:1/424 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGA 133
            |...|..:|:||:.::|||:||||:|.:|:|....||||||.|.||.|:..::||||||||.|||
Human    10 CEADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGA 74

  Fly   134 TVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDGGDATH 198
            .|:|::|||:|||:..|||:|:||||::||:|||:||:.||:::.:|......|:|||||||.|:
Human    75 EVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTN 139

  Fly   199 LMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDS 263
            |:..|||.....||||.||:.||||.||.:...|.|.||||||||||||:|||..|.||:|::|.
Human   140 LIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDG 204

  Fly   264 LKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIR 328
            :||.||:|..||..|:.|||||||||||:|:|.|..|.:||:|||.||||||:|:.|..::|..:
Human   205 IKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQ 269

  Fly   329 TVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPD 393
            ..::.||.||..::|...|..:||:..|:||:||...||||..|:...:....::.|||..|..:
Human   270 EGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKN 334

  Fly   394 GRMIILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSAPGRYKSDVYLLPKKMDEYVASL 457
            ||.||||||||||||.|:. ..|||:|.:.:.|.:|.|||::.|.:|...|:.||||:||.||..
Human   335 GRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEA 399

  Fly   458 HLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491
            ||...:..||:||::|::::|::..||||.::||
Human   400 HLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 213/417 (51%)
AdoHcyase 67..491 CDD:283003 215/422 (51%)
AHCYNP_001309015.1 AdoHcyase 10..433 CDD:283003 215/422 (51%)
PRK05476 12..428 CDD:235488 212/415 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S93
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.