DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL2 and ahcyl1

DIOPT Version :9

Sequence 1:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001121447.1 Gene:ahcyl1 / 100158541 XenbaseID:XB-GENE-942022 Length:278 Species:Xenopus tropicalis


Alignment Length:235 Identity:137/235 - (58%)
Similarity:167/235 - (71%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKMP-ETTFAD-----LSLADKTAVKKSSIEARRFSDVSTCSFSSTCFTGSSDEEDVSPKDNHQ 59
            ::|.| :..|||     .....||..:..|   |..|..||.|:||    .|||:| .||:|..|
 Frog    24 VSKTPKKIQFADDMQEFSKFPTKTGRRSLS---RSISQSSTDSYSS----DSSDDE-TSPRDKQQ 80

  Fly    60 RNSAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVL 124
            ..|.|..|||||:|.::.||||||||||.||..:::|||||:.||||.||.||||||:.||:.||
 Frog    81 ITSKGSADFCVKNIKQADFGRREIEIAEQEMMALISLRKRAQGEKPLLGAKIVGCTHITAQTGVL 145

  Fly   125 IETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSD-GWQPNL 188
            ||||..|||..||:|||||||||.|||||||:|:.||||:||:|::||||:||.:.:| |||.|:
 Frog   146 IETLCALGAQCRWSACNIYSTQNEVAAALAESGVAIFAWKGESEDDFWWCIDRCVNADSGWQANM 210

  Fly   189 ILDDGGDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYML 228
            |||||||.||.:.||||..:|.||||||||||||||.:.|
 Frog   211 ILDDGGDLTHWVYKKYPHVYKQIRGIVEESVTGVHREFGL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 113/167 (68%)
AdoHcyase 67..491 CDD:283003 112/163 (69%)
ahcyl1NP_001121447.1 NADB_Rossmann 88..>246 CDD:304358 109/157 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I1628
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 1 1.000 - - FOG0003070
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23420
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.