DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-d and AT5G55290

DIOPT Version :10

Sequence 1:NP_650578.1 Gene:VhaM9.7-d / 42041 FlyBaseID:FBgn0038458 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_568823.1 Gene:AT5G55290 / 835622 AraportID:AT5G55290 Length:70 Species:Arabidopsis thaliana


Alignment Length:67 Identity:19/67 - (28%)
Similarity:36/67 - (53%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAFMVITVFWLLFAIIGFLVSY-------RYEERGLIRCCVILTA-VCCYLAWMVTFVMQLNPLT 61
            :.|::.|   |:|.::|.:.|.       |.....|:...:::|| |||::.|.:.::.|:|||.
plant     1 MGFLITT---LIFVVVGIIASLCVRICCNRGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLI 62

  Fly    62 GP 63
            .|
plant    63 VP 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-dNP_650578.1 ATP_synt_H 7..64 CDD:461663 19/65 (29%)
AT5G55290NP_568823.1 ATP_synt_H 2..65 CDD:461663 19/66 (29%)

Return to query results.
Submit another query.