DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-d and AT4G26710

DIOPT Version :10

Sequence 1:NP_650578.1 Gene:VhaM9.7-d / 42041 FlyBaseID:FBgn0038458 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_194401.1 Gene:AT4G26710 / 828778 AraportID:AT4G26710 Length:70 Species:Arabidopsis thaliana


Alignment Length:67 Identity:20/67 - (29%)
Similarity:38/67 - (56%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAFMVITVFWLLFAIIGFLVSY-------RYEERGLIRCCVILTA-VCCYLAWMVTFVMQLNPLT 61
            :||:|.:   |:||::|.:.|.       :.....|:...:::|| |||::.|.:.::.|:|||.
plant     1 MAFVVTS---LIFAVVGIIASICTRICFNKGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLI 62

  Fly    62 GP 63
            .|
plant    63 VP 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-dNP_650578.1 ATP_synt_H 7..64 CDD:461663 19/65 (29%)
AT4G26710NP_194401.1 ATP_synt_H 3..65 CDD:461663 19/65 (29%)

Return to query results.
Submit another query.