DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and LHX4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:262 Identity:56/262 - (21%)
Similarity:91/262 - (34%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 RVVC-GDF-----NGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQI 442
            |:|| .|:     |..:....:|.|.|.|..|...|:..:..:....|..|.:::....|..|.:
Human   137 RLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVV 201

  Fly   443 KIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQ-------VQQQQQQQQ 500
            ::||||||.|.|:       :.:.|.|.|..|.....:.:..|::|.|:       |...:...:
Human   202 QVWFQNRRAKEKR-------LKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFR 259

  Fly   501 QQQQQQQQQH---------------------------QQQQ-----------QQPQDHHSIIAHN 527
            :.|...:..|                           |..|           |.|....|:.:|.
Human   260 EDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHA 324

  Fly   528 P--GHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIGGG------LGGNLGMM-------SALDKS 577
            |  ..|.::|    |..||:....|.||......:.||      .|.::|..       |.||:.
Human   325 PLLNGLDYTV----DSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEM 385

  Fly   578 NH 579
            :|
Human   386 DH 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762 3/6 (50%)
Homeobox 160..213 CDD:306543 16/52 (31%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 5/19 (26%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.