DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PHOX2B

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens


Alignment Length:292 Identity:71/292 - (24%)
Similarity:98/292 - (33%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 KSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGV 351
            :||....||        |..|||.|.|:...|.:....:.:........|..||           
Human    15 ESCMAGMDT--------SSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL----------- 60

  Fly   352 MPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGC----PRRRGRQTYTRFQTLE 412
            .||:...|             ||.|...||:..|....|....|.    .:||.|.|:|..|..|
Human    61 TPGSCSLG-------------TLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKE 112

  Fly   413 LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKM 477
            ||:.|...||.....|.|:|..:.|||.::::||||||.|.:|:.||.                .
Human   113 LERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA----------------A 161

  Fly   478 KAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQ-QQQQQPQDHHSIIAHNPGHLHHSVVGQNDL 541
            .|....|:....|:....:..:.::.:....... .....|....|..|:..|            
Human   162 AAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGG------------ 214

  Fly   542 KLGLGMGVGVGVGGIGPGIGGGLGGNLGMMSA 573
              |.|.......|..|||..||..|..|..:|
Human   215 --GGGPSPAGAPGAAGPGGPGGEPGKGGAAAA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 23/52 (44%)
polyalanine repeat 241..260 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.